Internationell statistisk klassifikation av sjukdomar

advertisement
Internationell statistisk
klassifikation av sjukdomar
och relaterade hälsoproblem
Systematisk förteckning
Svensk version 2017
Del 1 (3)
Svensk version av International Statistical Classification of Diseases and Related
Health Problems, Tenth Revision (ICD-10)
Klassifikationen är publicerad av Världshälsoorganisationen (WHO) 1992 med titeln
International Statistical Classification of Diseases and Related Health Problems,
Tenth Revision (ICD-10).
Den svenska titeln är Internationell statistisk klassifikation av sjukdomar och
relaterade hälsoproblem – Systematisk förteckning, svensk version 2017
(ICD-10-SE).
Socialstyrelsen är ensam ansvarig för översättningen.
© World Health Organization 1992
Denna publikation skyddas av upphovsrättslagen. Vid citat ska källan uppges. För
att återge bilder, fotografier och illustrationer krävs upphovsmannens tillstånd.
Publikationen finns som pdf på Socialstyrelsens webbplats. Publikationen kan också
tas fram i alternativt format på begäran. Frågor om alternativa format skickas till
[email protected]
978-91-7555-419-8
ISBN
Artikelnummer 2017-4-2
Publicerad
www.socialstyrelsen.se, april 2017
Förord – fjärde upplagan
Socialstyrelsen publicerar härmed fjärde upplagan av Internationell statistisk
klassifikation av sjukdomar och relaterade hälsoproblem – Systematisk förteckning
(ICD-10-SE). Den ersätter från och med den 1 januari 2016 den andra upplagan av
klassifikationen.
För att markera att detta är den svenska versionen av The International Statistical
Classification of Diseases and Related Health Problems, Tenth Revision (ICD-10),
som utgivits av Världshälsoorganisationen (WHO), används den svenska
förkortningen ICD-10-SE. Avsikten är att understryka att klassifikationen är
internationell och att den utöver sjukdomar innehåller många olika former av
relaterade hälsoproblem som kan föranleda kontakt med hälso- och sjukvården. Den
är alltså inte en förteckning över ”godkända” sjukdomar och inte heller en
nomenklatur eller en klinisk terminologi.
I denna fjärde upplaga har ett antal koder tillkommit, ändrats eller utgått. Sedan år
1995 har WHO årligen uppdaterat ICD-10. Dessa ändringar har successivt översatts
och införts i den svenska versionen och gjorts tillgängliga för användarna i form av
ändringslistor som publicerats av Socialstyrelsen.
Svenska fördjupningskoder, dvs. mera detaljerade uppdelningar än vad ICD-10 i sin
grundform erbjuder, har efterhand tillkommit och uppdaterats. De finns också
samlade i en särskild förteckning på Socialstyrelsens webbplats.
I denna upplaga har fördjupningskoderna lagts in under berörda kategorier eller
subkategorier. Användningen av fördjupningskoder är frivillig.
I denna utgåva har av utrymmesskäl vissa avsnitt från den första utgåvan utelämnats:
Specialister som medverkat
Morfologisk (histologisk) klassificering av tumörer
Förteckning över vissa kategorier med gemensamma egenskaper
Förteckning över avvikelser mellan Klassifikation av sjukdomar och hälsoproblem
1997 och Internationell Statistical Classification of Diseases and Related Health
Problems, Tenth Revision (ICD-10)
Den fjärde utgåvan av ICD-10-SE publiceras i tre delar, kapitel 1-6, (del 1), kapitel
7-16 (del 2) och kapitel 17-22 (del 3). Innehållsförteckningen visar alla tre delarna där
den aktuella innehållsförteckningen för respektive del är skriven i fet stil.
Förutom de allmänna anvisningar för användning som finns i avsnittet Inledning i den
första upplagan har senare särskilda anvisningar utformats, t.ex. beträffande val av
huvud- och bidiagnos och klassifikationens användning i öppen specialistvård.
Anvisningar och övriga utelämnade avsnitt publiceras som separata dokument på
Socialstyrelsens webbplats (www.socialstyrelsen.se/klassifikationer).
Socialstyrelsen i maj 2017
Mona Heurgren
Olivia Wigzell
Förord – första upplagan
Socialstyrelsen publicerar härmed Klassifikation av sjukdomar och hälsoproblem
1997. Klassifikationen är i första hand utformad för sjukhusbruk och skall användas i
sjukhusens patientstatistik med början den 1 januari 1997. Den ersätter Klassifikation
av sjukdomar 1987.
Den nya klassifikationen är en svensk version av The International Statistical
Classification of Diseases and Related Health Problems, Tenth Revision (ICD-10),
som utgivits av Världshälsoorganisationen (WHO). Den är avsedd som en
basklassifikation för allmänt medicinskt-statistiskt bruk.
Denna nya klassifikation skiljer sig i flera avseenden från föregångaren.
Kapitelindelningen är utvidgad och ändrad, kodstrukturen ny, detaljrikedomen större,
dubbelkodningssystemet utvidgat, antalet koder i det närmaste fördubblat etc. Stora
förändringar av innehållet finns i flera kapitel. De väsentliga nyheterna presenteras i
inledningen.
Den svenska versionen har tillkommit inom Socialstyrelsen under ledning av en
styrgrupp. Det direkta arbetet har utförts av en projektgrupp under ledning av
professor Björn Smedby, föredragande läkare i klassifikationsfrågor vid
Socialstyrelsen. I gruppen har som konsulter medverkat professor emeritus Ragnar
Berfenstam, överläkare Lennart Jonsson, föredragande läkaren Richard Nightingale
samt framlidna överläkaren Anna Christina Nilsson. Vissa principfrågor rörande
språket i klassifikationen har diskuterats med Svenska Läkaresällskapets kommitté för
medicinsk språkvård. Sällskapets medicinska språkrådgivare, fil lic Hans Nyman, har
svarat för utformningen av det latinska språket i klassifikationen. Professor Jan
Ericson har svarat för översättningen av förteckningen över morfologikoder. Inom
styrelsen har i första hand Dag Swenson och Anita Nilsson handlagt ärendet.
Inledningen till klassifikationen, som bl a innehåller praktiska anvisningar för
användningen, har utformats av Björn Smedby.
I det medicinska granskningsarbetet har representanter för ett stort antal av Svenska
Läkarsällskapets specialistsektioner genomfört omfattande och mycket värdefulla
insatser. Sektionernas kontaktpersoner framgår av separat förteckning. Förslag till den
svenska versionen har varit föremål för flera omfattande remissbehandlingar av
berörda myndigheter och organisationer samt Svenska Läkaresällskapets sektioner. En
hel del synpunkter och ändringsförslag har därvid framkommit som dock inte kunnat
tillgodoses då de stått i strid med det grundläggande beslutet om bundenhet till
WHO:s ICD-10. Denna bundenhet motiveras av Sveriges åtaganden som
medlemsland i WHO och av önskvärdheten av internationell jämförbarhet i hälso- och
sjukvårdsstatistiken. En alfabetisk förteckning publiceras i en särskild volym.
Denna basklassifikation kan behöva byggas ut eller modifieras för särskilda behov
och ändamål. Speciella versioner har utformats för primärvård, tandvård och psykiatri.
Mer detaljerade uppdelningar kan bli aktuella även för andra medicinska specialiteter
och resultera i specialistanpassade tillägg till klassifikationen.
Socialstyrelsen i juli 1996
Claes Örtendahl
Måns Rosén
Innehåll
Del 1
Förord ............................................................................................................................ 3
Tecken och ordförklaringar ..................................................................................................... 6
Inledning ................................................................................................................................... 9
Översiktlig förteckning över innehållet i klassifikationens kapitel ..................................21
1. Vissa infektionssjukdomar och parasitsjukdomar (A00−B99) ..................................... 23
2. Tumörer (C00−D48) ......................................................................................................... 72
3. Sjukdomar i blod och blodbildande organ samt vissa rubbningar i immunsystemet
(D50−D89)…………………………………………………………………………………………130
4. Endokrina sjukdomar, nutritionsrubbningar och ämnesomsättningssjukdomar
(E00−E90).……………………………………………………………………………………….. 144
5. Psykiska sjukdomar och syndrom samt beteendestörningar (F00−F99) . ................ 173
6. Sjukdomar i nervsystemet (G00−G99) ........................................................................ 226
Del 2
Översiktlig förteckning över innehållet i klassifikationens kapitel ........................................ 257
7. Sjukdomar i ögat och närliggande organ (H00−H59) . ......................................................260
8. Sjukdomar i örat och mastoidutskottet (H60−H95) . ..........................................................282
9. Cirkulationsorganens sjukdomar (I00−I99) ..................................................................... 290
10. Andningsorganens sjukdomar (J00−J99). ...................................................................... 317
11. Matsmältningsorganens sjukdomar (K00−K93) .............................................................. 338
12. Hudens och underhudens sjukdomar (L00−L99) . ........................................................... 370
13. Sjukdomar i muskuloskeletala systemet och bindväven (M00−M99) .............................. 397
14. Sjukdomar i urin- och könsorganen (N00−N99) . ............................................................ 438
15. Graviditet, förlossning och barnsängstid (O00−O99) ....................................................... 465
16. Vissa perinatala tillstånd (P00−P96) . ............................................................................. 498
Del 3
Översiktlig förteckning över innehållet i klassifikationens kapitel ........................................ 502
17. Medfödda missbildningar, deformiteter och kromosomavvikelser (Q00−Q99)................. 505
18. Symtom, sjukdomstecken och onormala kliniska fynd och laboratoriefynd som ej
klassificeras annorstädes (R00−R99) ... .......................................................................... 542
19. Skador, förgiftningar och vissa andra följder av yttre orsaker (S00−T98) . ..................... 569
20. Yttre orsaker till sjukdom och död (V01−Y98) . ............................................................... 649
21. Faktorer av betydelse för hälsotillståndet och för kontakter med hälso- och sjukvården
(Z00−Z99) ...................................................................................................................... 709
22. Koder för särskilda ändamål (U00-U99).......................................................................... 746
Specialister som medverkat ................................................................................ .se.www.socialstyrelsen.se
Morfologisk (histologisk) klassificering av tumörer ............................................... se.www.socialstyrelsen.se
Förteckning över vissa kategorier med gemensamma egenskaper..................... se.www.socialstyrelsen.se
Förteckning över avvikelser mellan Klassifikation av sjukdomar och
hälsoproblem 1997 och International Statistical Classification of Diseases
and Related Health Problems............................................................................... se.www.socialstyrelsen.se
5
Tecken- och ordförklaringar
†
Tecknet ”dagger” (dolk, kors) markerar en etiologisk kod som kan
dubbelklassificeras med manifestationskod (*)
*
Asterisk markerar en manifestationskod. Skall alltid dubbelklassificeras
med en etiologisk kod
.-
Beteckningen .- efter en treställig diagnoskod i en hänvisning innebär att
hänvisningen avser samtliga förekommande decimaler inom kategorin
()
Används kring kompletterande formuleringar eller förklarande uttryck.
[]
Hakparentes används kring synonymer eller förkortningar
Typografisk markering av koder på kategorinivå
Typografisk markering av koder på kategorinivå som i patientstatistik i
Sverige kan ersättas av annan kod
Aktivitetskod
Kod för precisering av typ av aktivitet hos den skadade personen vid
tiden för den yttre orsakens inverkan. Avsedd att användas som
femtepositionsuppdelning av kategorierna V01–Y34 i tillämpliga fall.
Återfinns i början av kapitel 20
Alfabetisk förteckning
Index över termer för diagnoser och tillstånd. Förteckningen är inte
heltäckande och skall endast ses som ett hjälpmedel vid klassificering
Alfanumerisk kod
Kodbeteckning som utgörs av såväl alfabetiska som numeriska tecken
Asteriskkod (*)
Kod för manifestation eller lokalisation. Avser vissa i klassifikation
särskilt angivna diagnoser
ATC-kod
Kod enligt Anatomical Therapeutic Chemical Classification System.
Tillämpas i FASS och används i klassifikationen som alternativ till de
läkemedelskoder som anges i kodserien T36–T50
Avsnitt
Varje kapitel av klassifikationen är indelat i avsnitt med egen rubrik som
omfattar grupper av likartade sjukdomar eller tillstånd
Barnsängstid
Omfattar tiden t.o.m. 42 dagar efter förlossning
Bidiagnos
Annan diagnos än huvuddiagnos
Daggerkod (†)
Kod för etiologisk diagnos. Används tillsammans med asteriskkod
DRG
Diagnosis Related Groups. Ett amerikanskt patientklassificeringssystem
som bl.a. bygger på ICD-koder
DSM
Diagnostic and Statistical Manual of Mental Disorders. En amerikansk
klassifikation som används inom psykiatrin. DSM-5 är den senaste
utgåvan. Finns även i svensk översättning
6
Dubbelkodning
Innebär att en sjukdom eller ett tillstånd klassificeras med två koder,
t.ex. med dagger- och asteriskkod eller med koder för en skadas natur
och uppkomstsätt
E-serien
Tilläggsklassifikation i KS87 avseende ”Yttre orsaker till skador och
förgiftningar”. Denna har i KSH97 ersatts av kap 20 (V01–Y98)
Etiologisk diagnos
Diagnos angiven utifrån uppkomstsätt eller avseende grundsjukdom.
Se även daggerkod
FASS
Farmacevtiska specialiteter i Sverige – Förteckning över
humanläkemedel. Utgör läkemedelsindustrins gemensamma förteckning
FASS-kod
I FASS angiven alfanumerisk kod (max 7 tecken) enligt ATC för
klassificering av läkemedel
HSLF-FS
Gemensamma författningssamlingen avseende hälso- och sjukvård,
socialtjänst, läkemedel, folkhälsa m.m.
Huvuddiagnos
Definieras i patientstatistik som det tillstånd för vilket patienten
huvudsakligen utretts eller behandlats under sjukhusvistelsen. Om mer
än ett tillstånd kan komma ifråga som huvuddiagnos bör det tillstånd
väljas som tagit mest sjukvårdsresurser i anspråk
ICD
International Classification of Diseases
ICD-10
International Statistical Classification of Diseases and Related Health
Problems. Tenth Revision
ICD-9
International Statistical Classification of Diseases, Injuries, and Causes
of Death. Ninth Revision
ICD-O-2
International Classification of Diseases for Oncology, Second Edition
Inklusionstermer
Exempel på sjukdomar och tillstånd som ingår i den aktuella kategorin
eller subkategorin
Innefattar
Förtydligande information om sjukdomar och tillstånd som ingår i den
aktuella kategorin eller subkategorin
Kapitel
Huvudindelning av klassifikationen. ICD-10 är indelad i 22 kapitel
Kategori
Basal indelning av klassifikationen. Kategorier betecknas med treställiga
alfanumeriska koder
KKÅ97
Klassifikation av kirurgiska åtgärder 1997. Svensk version av
NOMESCO Classification of Surgical Procedures
KS87
Klassifikation av sjukdomar 1987. Svensk version av ICD-9
KSH97
Klassifikation av sjukdomar och hälsoproblem 1997. Svensk version av
ICD-10
KSH97-P
Specialistversion av KSH97 avsedd att tillämpas inom primärvården
7
KSH97-T
Specialistversion av KSH97 avsedd att tillämpas inom tandvården
Manifestationsdiagnos
Diagnos avseende manifestation eller lokalisation av viss sjukdom. Se
även asteriskkod
Morfologisk kod
Kod för angivande av histologisk indelning av tumörer enligt ICD-O-2
Och
Ordet ”och” i klassifikationens sjukdoms- och skadebeteckningar skall i
denna klassifikation som regel tolkas som ”och/eller”. Båda komponenterna i en sammansatt beteckning förutsätts sålunda inte föreligga
samtidigt. Om samtidig förekomst krävs används i stället ordet ”jämte”
eller annan förtydligande formulering
Patientstatistik
Avser den registrering av vårdtillfällen i sluten vård vid sjukhus som
rapporteras till Socialstyrelsen för nationell statistik och forskning
Perinatala perioden
Tiden efter utgången av graviditetsvecka 22 t o m 7 dagar efter födseln
(enligt WHO:s definition). Vid beräkning av perinatal mortalitet används
i Sverige tiden efter utgången av graviditetsvecka 28
Platskod
Kod för precisering av olycksplats som kan användas tillsammans med
flertalet koder inom kapitel 20 (kategorierna W00-Y34 med undantag av
Y06-Y07) i form av en fjärdeposition (decimal). Återfinns i början av
kapitel 20
Primärdiagnos
Benämning på diagnos då den kompletterats med tilläggsdiagnos för att
precisera fallet
SOSFS
Socialstyrelsens författningssamling
Subkategori
Klassifikationens kategorier är oftast indelade i subkategorier som
betecknas med fyrställiga alfanumeriska koder (en bokstav och två
siffror samt en decimal som avskiljs med en punkt). Om en kategori inte
är uppdelad i subkategorier bör den treställiga koden vid registrering
kompletteras med decimalen
Tilläggsdiagnos
Benämning på en diagnos som kompletterar en primärdiagnos för att
precisera fallet
UNS
Utan närmare specifikation. Klassifikationsteknisk beteckning som
främst förekommer i uppräkning av inklusionstermer. Betyder att
diagnosen ifråga i primärmaterialet inte är försedd med någon bestämning till huvudordet som skulle kunna modifiera kodningen
Utesluter
Förtydligande information om sjukdomar och tillstånd som inte
innefattas i en kategori eller subkategori. Inom parentes anges de kodnummer till vilka hänvisning sker.
V-serien
Tilläggsklassifikation i KS87 avseende ”Faktorer av betydelse för
hälsotillståndet och kontakterna med hälso- och sjukvården”. Denna har
i KSH97 ersatts av kapitel 21 (Z00-Z99)
WHO
Världshälsoorganisationen
8
Inledning
sjukdomsklassifikationer som speglade den
tidens förhärskande sjukdomsläror. Av särskilt
svenskt intresse är den av Linné 1763 utgivna
Genera morborum (Sjukdomsgrupperna) som
ordnade 325 olika sjukdomar och symtom i
klasser och ordningar. I mitten på 1800-talet
lade den engelske medicinske statistikern
William Farr fram ett förslag till en
internationell dödsorsaksklassifikation som
delade in dödsorsakerna i fem stora grupper:
En sjukdomsklassifikation kan definieras som
ett system för att ordna sjukdomar i klasser och
grupper. Det finns många tänkbara principer
eller axlar efter vilka en sådan klassifikation
kan byggas upp. Man kan t.ex. utgå från
anatomi eller topografi (den drabbade
kroppsdelen, det sjuka organet),
sjukdomsprocessens natur (inflammation,
tumör etc.), sjukdomens orsak och
uppkomstmekanism (bakteriell infektion,
skada genom yttre orsak etc.). Vilken axel man
bör välja beror på vad klassifikationen främst
ska användas till.
• epidemiska sjukdomar
• generaliserade sjukdomar
• lokaliserade, anatomiskt definierade
sjukdomar
• utvecklingsrubbningar
• skador genom yttre våld
Denna klassifikation är den svenska versionen
av den tionde revisionen av The International
Statistical Classification of Diseases and
Related Health Problems (ICD-10) som utgavs
av Världshälsoorganisationen (WHO) 1992.
Den är liksom sina föregångare en statistisk
klassifikation, d.v.s. ett system för att på ett
meningsfullt sätt gruppera sjukdomar och
dödsorsaker för översiktliga statistiska
sammanställningar och analyser. Kravet på en
statistisk klassifikation av detta slag är att den
täcker alla tänkbara sjukliga tillstånd och
hälsoproblem inom ett hanterbart och därför
rimligt antal kategorier.
Den grundstrukturen levde vidare i ett nytt
förslag som fransmannen Jaques Bertillon lade
fram vid den internationella statistiska
unionens möte 1893. Då fastställdes den första
listan över dödsorsaker som syftade till att
möjliggöra jämförelser av dödligheten mellan
olika länder. Listan reviderades sedan vart
tionde år men bibehöll i stort sin grundstruktur.
Den sjätte revisionen gjordes 1948 av den då
nybildade Världshälsoorganisationen (WHO)
och innebar att ICD kom att omfatta även
sjukdomar som normalt inte leder till döden.
Den blev därigenom lämpad även för
sjukhusbruk och annan sjuklighetsstatistik.
WHO har därefter ansvarat för de revisioner
som även fortsättningsvis skett ungefär vart
tionde år. WHO kräver av alla medlemsländer
att de ska använda ICD för internationell
rapportering av sjukdomar och dödsorsaker. På
det sättet skapas förutsättningar för en
internationellt jämförbar mortalitets- och
morbiditetsstatistik.
Det primära syftet med ICD-10 och denna
svenska motsvarighet, Internationell statistisk
klassifikation av sjukdomar och relaterade
hälsoproblem (ICD-10-SE), är sålunda att
möjliggöra klassificering och statistisk
beskrivning av sjukdomar och andra
hälsoproblem som är aktuella som orsak till
människors död eller kontakter med hälso- och
sjukvården. Förutom traditionella diagnoser
måste klassifikationen därför omfatta ett brett
spektrum av symtom, onormala fynd, besvär
och sociala förhållanden.
ICD har hela tiden haft samma grundstruktur
som den som William Farr föreslog för 150 år
sedan. Farr arbetade med folkhälsofrågor
(public health) och hans klassifikationsidé bär
tydliga spår av det samhällsmedicinska
arbetets behov. Statistiken skulle vara till
ledning för infektionsbekämpande och
omgivningshygien, för förebyggande av
Kort historik
Den internationella sjukdomsklassifikationen
(ICD) som blivit en över hela världen
accepterad standard för klassifikation av
sjukdomar har en lång historia. Under 1600och 1700-talen framlades flera olika
9
Genom den utbyggda datoriseringen i
sjukvården har betydelsen och användningen
av sjukdomsklassifikationen ökat ytterligare.
En praktiskt viktig uppgift vid sidan av den
statistiska är användningen som sökregister i
sjukvårdens journalarkiv. Den är ett viktigt
instrument i all medicinsk
informationsverksamhet och genom sina
standardiserade koder ett betydelsefullt
internationellt kommunikationshjälpmedel. På
senare år har diagnosinformationen på sjukhus
också kommit att användas som bas för olika
system för verksamhetsbeskrivning och
kvalitetskontroll. Det s.k. DRG-systemet - som
arbetar med diagnosrelaterade grupper
baserade på ICD - har tagits i anspråk för
resursfördelning inom sjukvården och lagts till
grund för ekonomisk ersättning till sjukhus på
vissa håll.
mödra- och barnadödlighet och för prevention
av yrkessjukdomar och olycksfallsskador. Man
kan säga att den tidens folkhälsoproblem har
satt en bestående prägel på klassifikationen.
Det behöver emellertid inte vara någon
nackdel, eftersom det i WHO:s globala
perspektiv fortfarande är just dessa aspekter
som är de viktigaste i det världsomspännande
folkhälsoarbetet.
Arbetet på ICD-10 påbörjades i WHO 1983.
Den internationella revisionskonferensen
avseende ICD-10 hölls 1989 i Genève.
Världshälsoförsamlingen antog
klassifikationen 1990 med avsikt att den skulle
träda i kraft 1993. Framställningen av den
engelska originalversionens olika delar tog
emellertid längre tid än beräknat och inte
förrän i mitten av 1990-talet kunde man börja
använda nationella översättningar av den nya
klassifikationen i vissa länder.
För en fullständig beskrivning och analys av
den sjukvårdande verksamheten är inte ICD-10
tillräcklig. WHO har lanserat begreppet ”a
family of disease and health-related
classifications”. I denna familj ingår ICD-10
som en kärna. En serie av
specialitetsanpassade klassifikationer har
emellertid också utarbetats och förväntas bli
publicerade både internationellt och nationellt.
Ett exempel på detta är den av WHO utgivna
International Classification of Diseases for
Oncology, andra upplagan (ICD-O-2). WHO
har även gett ut specialistanpassade
klassifikationer inom det psykiatriska området
och för tandvård. Arbete pågår på
specialistanpassade internationella
klassifikationer baserade på ICD inom flera
andra områden såsom neurologi, dermatologi,
reumatologi och ortopedi samt pediatrik.
I Sverige ersätter den nu publicerade svenska
versionen av ICD-10 den av Socialstyrelsen
utgivna Klassifikation av sjukdomar 1987 som
byggde på ICD-9. Den nya klassifikationens
namn understryker dess syfte att vara ett
instrument för främst statistiska
sammanställningar men också en eftersträvad
breddning till andra aspekter än
sjukdomsdiagnoser för att beskriva hälso- och
sjukvårdens olika verksamheter.
Klassifikationen tas i bruk fr.o.m. år 1997.
Klassifikationens
användningsområde
Klassifikationen av sjukdomar och relaterade
hälsoproblem är ett nödvändigt verktyg för
beskrivning av dödsorsaksmönstret och
sjukdomspanoramat i en befolkning och för
annan epidemiologisk forskning. I Sverige har
den fått en mycket bred användning. Den
används för patientstatistik i öppen och sluten
vård och i de regionala och centrala register
som byggs upp från denna statistik. Den är
grunden för registrering av dödsorsaker hos
Socialstyrelsen. Den används också inom
sjukförsäkringen och för statistik över
arbetsskador. Den utnyttjas för registrering av
sjukdomar inom företagshälsovården och inom
försvaret. Den används dessutom i en rad olika
forskningsregister.
ICD-10 är däremot inte avsedd för att
klassificera medicinska åtgärder som t.ex.
kirurgiska operationer. På grund av
svårigheterna att få internationell enighet inom
ett område där utvecklingen går så snabbt som
inom kirurgin, har WHO avstått från att
uppdatera en tidigare publicerad internationell
klassifikation för medicinska åtgärder. Man
förutsätter att olika länder eller grupper av
länder arbetar fram egna
operationsklassifikationer, såsom t.ex. skett
genom samarbete mellan de nordiska länderna.
10
Klassifikationens principiella
uppbyggnad
huvuddiagnos, kan kodas i flera kapitel ska
den kodas i det kapitel som har högst prioritet.
Sjukdomsklassifikationen är hierarkiskt
uppbyggd av sjukdomsgrupper och
sjukdomskategorier. ICD-10 består av 22
kapitel. Dessa är i sin tur indelade i avsnitt som
omfattar grupper av likartade sjukdomar.
Avsnitten består av ett antal kategorier som
ofta representerar enskilda sjukdomar.
Kategorierna motsvaras av treställiga
alfanumeriska koder (en bokstav och två
siffror). Kategorierna är i sin tur oftast
indelade i subkategorier som betecknas med
fyrställiga koder (en bokstav, trå siffror och en
decimal som avskiljs med en punkt).
Subkategorierna kan t.ex. avse olika typer av
en viss sjukdom eller olika stadier av
sjukdomen.
Eftersom det måste vara möjligt att klassificera
alla förekommande sjukdomar och
hälsoproblem - även sådana som inte var kända
när klassifikationen gjordes - innehåller
klassifikationen restgrupper på olika nivåer för
andra specificerade men inte särskilt nämnda
sjukdomar av likartat slag. Det finns dessutom
ofta en avslutande kategori eller subkategori
för sådana fall som inte specificerats eller inte
kunnat specificeras så långt som
klassifikationen tillåter. Den får beteckningen
”ospecificerad” eller UNS som står för ”utan
närmare specifikation”.
För att underlätta användningen av
klassifikationen och förtydliga var olika
tillstånd hör hemma anges under rubrikerna till
olika kodnummer ofta ett antal s.k.
inklusionstermer. Dessa är till skillnad från
rubrikerna tryckta med mager stil och med
indragning från vänstermarginalen. De utgörs
av synonymer till rubriktexten eller avser mer
specificerade tillstånd som omfattas av den
aktuella kategorin eller subkategorin. Det är
viktigt att framhålla att inklusionstermerna inte
utgör en fullständig förteckning av vad som
innefattas. De ska främst ses som exempel.
Kapitelindelningen styrs av flera principer.
Förutom olika kapitel för varje större
organsystem finns kapitel som främst bygger
på etiologi eller uppkomstsätt
(infektionssjukdomar, tumörer, medfödda
missbildningar och skador). En annan princip
ligger bakom de särskilda kapitlen för
graviditet och förlossning samt perinatala
tillstånd. Dessutom finns kapitel för symtom
och ofullständigt preciserade fall, yttre orsaker
till sjukdom och död samt faktorer av
betydelse för människors kontakter med hälsooch sjukvården.
Vad som ingår eller inte ingår i en viss
kategori eller subkategori förtydligas ibland
med hjälp av termerna Innefattar och
Utesluter, vilka också kan återfinnas under
rubriker till kapitel eller avsnitt. Dessa termer
används främst med avseende på sådana
tillstånd som inte självklart ska ingå eller
uteslutas. Utesluter åtföljs av en hänvisning till
annat kodnummer, dit den exkluderade
diagnosen i stället ska föras.
När man på detta sätt blandar olika
klassifikationsprinciper leder det till praktiska
svårigheter, eftersom det inte är självklart vart
man ska föra ett visst tillstånd. ICD bygger
därför på vissa överordnade
klassifikationsregler som innebär att vissa
kapitel har företräde framför andra.
I stort sett gäller följande prioritetsordning
mellan kapitlen:
1) Skador och förgiftningar (kapitel 19)
2) Graviditet, förlossning, barnsängstid samt
vissa perinatala tillstånd (15–16)
3) Infektionssjukdomar, tumörer och
missbildningar (1, 2 och 17)
4) Organsystemkapitlen (3-14),
symtomkapitlet (18) och Z-kapitlet (21)
Väsentliga nyheter i
klassifikationen
Fler kapitel
ICD-9 och därmed 1987 års svenska
klassifikation innehöll 17 kapitel och två
tilläggsklassifikationer: Yttre orsaker till
skador och förgiftningar (E-serien) samt
Faktorer av betydelse för hälsotillståndet och
kontakterna med hälso- och sjukvården (Vserien). Dessa båda serier har i ICD-10
Detta innebär inte att vissa tillstånd har
prioritet framför andra tillstånd. Däremot
innebär det att om det tillstånd, som är
11
att skilja svenska kodbeteckningar från 1987
års klassifikation från dem i denna
klassifikation.
inkorporerats i huvudklassifikationen och
utgör nu egna kapitel.
Sammanlagt omfattar klassifikationen nu 22
kapitel, eftersom man också gjort en
uppdelning av det tidigare ICD-9-kapitlet för
nervsystemets och sinnesorganens sjukdomar i
tre separata kapitel, nämligen Sjukdomar i
nervsystemet (kapitel 6), Sjukdomar i ögat och
närliggande organ (kapitel 7) och Sjukdomar i
örat och mastoidutskottet (kapitel 8). Eftersom
man också ändrat ordningsföljden mellan vissa
kapitel, har flertalet kapitel fått nya nummer.
Ändrat innehåll i vissa kapitel
ICD-10 rymmer många innehållsmässiga
nyheter som avspeglar den medicinska
utvecklingen inom olika områden. Många nya
sjukdomar har tillkommit. Synen på hur vissa
sjukdomar bör klassificeras har ändrats. Så har
t.ex. ändringar skett i klassificeringen av
maligna tumörer i lymfatisk och blodbildande
vävnad, diabetes, epilepsi och njursjukdomar.
Inom många kapitel har särskilda kategorier
tillkommit för läkemedelsutlösta och
postoperativa tillstånd. Generellt sett har
detaljrikedomen i klassifikationen ökat
väsentligt.
Ny kodstruktur
Själva kodstrukturen i klassifikationen har
också ändrats. De alfanumeriska koderna har
nu en bokstav som första tecken. Flertalet
kapitel disponerar sin egen bokstav. Undantag
gäller kapitel 1, Vissa infektionssjukdomar och
parasitsjukdomar, som disponerar två
bokstäver (A och B) liksom kapitel 2 Tumörer
(C och delar av bokstaven D). Senare delen av
bokstavsserien D används dock för kapitel 3
Sjukdomar i blod och blodbildande organ samt
vissa rubbningar i immunsystemet.
Ögonsjukdomarna och öronsjukdomarna delar
också på en bokstav (H). Kapitel 9 som
omfattar skador, förgiftningar och vissa andra
följder av yttre orsaker disponerar två
bokstäver (S och T) och kapitel 20 som avser
yttre orsaker till sjukdom och död disponerar
fyra bokstäver (V, W, X och Y).
Vissa mer omfattande överflyttningar mellan
kapitel har gjorts. Så har t.ex. rubbningar i
immunsystemet sammanförts med sjukdomar i
blod och blodbildande organ i ett och samma
kapitel. De mest omfattande innehållsmässiga
förändringarna finns i kapitlen avseende
psykiska sjukdomar och beteendestörningar
(kapitel 5), skador och förgiftningar (kapitel 9)
samt yttre orsaker till sjukdom och död (kapitel
20). Psykiska sjukdomar och syndrom samt
beteendestörningar har försetts med
beskrivningar av de olika tillstånden för att
tillgodose önskemålen om en mer enhetlig
diagnostik. Skadekapitlet har fått en helt ny
indelning som utgår från skadans lokalisation
och inte från dess typ. Yttre orsaker till skada
och sjukdom kodas efter ett delvis nytt system.
Av det engelska alfabetets 26 bokstäver har
man utnyttjat 26. Varje bokstav kan åtföljas av
siffrorna 00-99 och dessa treställiga koder kan
i sin tur delas upp med en decimal i fjärde
positionen. Det alfanumeriska systemet har
mer än fördubblat antalet tillgängliga koder i
förhållande till ICD-9 (vars internationella
version var rent numerisk). Vissa treställiga
koder har lämnats vakanta för framtida
utvidgningar och revisioner. Det ska sålunda
bli möjligt att bygga ut systemet utan att
behöva ändra på kodnummer som behåller sitt
innehåll oförändrat.
Varje kapitel inleds med anvisningar om vilka
tillstånd som inte ska klassificeras inom
kapitlet utan på annat ställe. Härigenom
klargörs prioritetsordningen mellan de olika
kapitlen. I kapitelinledningen finns också en
översikt över kapitlets struktur och en
uppräkning av de s.k. asteriskkoder som
återfinns i kapitlet (se vidare härom nedan).
Utvidgning av dagger-asterisk-systemet
Det system för dubbelklassificering av vissa
tillstånd som infördes redan i ICD-9 men som
bara delvis genomfördes i Klassifikation av
sjukdomar 1987 har byggts ut i ICD-10.
Systemet ger möjlighet att samtidigt
klassificera vissa tillstånd med hänsyn till både
etiologi och manifestation och kallas för
I Sverige infördes alfanumeriska koder i
Klassifikation av sjukdomar 1987 främst för
att enkelt kunna skilja på koder från olika
klassifikationsrevisioner. Man ersatte då den
fjärde positionen (en decimal) i ICD-9 med en
bokstav. Eftersom ICD-10 använder bokstav i
den första positionen, blir det fortfarande lätt
12
Oslo, Norge. Detta center svarar för
samordningen av arbetet med de nordiska
ländernas nationella versioner av ICD-10.
Eventuella förslag till ändringar eller tillägg i
ICD-10 ska dock i första hand riktas till den
nationella klassifikationsmyndigheten, d.v.s. i
Sverige till Socialstyrelsen.
dagger-asterisk-systemet efter beteckningen på
de typografiska tecken som markerar de olika
slagen av koder i ICD-10. Asteriskkoder
avsedda för lokaliserade manifestationer av
vissa sjukdomar har samlats i 83 särskilda
treställiga kategorier (se härom nedan).
Morfologikoder tillkommit
Inom kapitel 2 klassificeras tumörer i första
hand i stora grupper med avseende på
tumörens natur (malignitetsgrad) och inom
dessa grupper efter anatomisk lokalisation.
Däremot sker som regel ingen uppdelning efter
tumörernas morfologiska (histologiska) typ.
Språk och terminologi
Klassifikation och inte nomenklatur
Genom klassifikationens breda användning
inom sjukvården blir dess språk och
terminologi av betydelse för det medicinska
fackspråket. Det förtjänar dock understrykas
att det här primärt är fråga om en statistisk
klassifikation och inte en nomenklatur, d.v.s.
en förteckning över riktiga eller
rekommenderade beteckningar eller termer.
Klassifikationens språk är sålunda inte
bindande för formuleringen av de diagnoser
som anges i patientjournaler eller annan
medicinsk dokumentation.
Som separat bilaga att ladda ner på
Socialstyrelsens webbplats återfinns emellertid
särskilda s.k. morfologikoder hämtade från
andra upplagan av International Classification
of Diseases for Oncology (ICD-O-2). Vissa
hänvisningar finns i kapitel 2 till dessa koder.
Den som önskar ange en tumörs histologiska
typ kan göra det genom att använda dessa
morfologikoder som tillägg till diagnoskoderna
från kapitel 2. Svenska patologer använder
histologiska koder som mycket nära
överensstämmer med morfologikoderna i
ICD-O-2.
Som redan nämnts utgörs flera av
klassifikationens kategorier och subkategorier
av s.k. restgrupper för andra i grundmaterialet
– t.ex. patientjournalen – specificerade men i
klassifikationen inte särskilt nämnda
sjukdomar. Det ligger i sakens natur att
beteckningarna på sådana restgrupper inte kan
användas som diagnoser.
Uppdateringsmöjlighet
Samtidigt som ICD-10 fastställdes av WHO
beslutades också om en ny mekanism för att
möjliggöra uppdateringar av ICD mellan
revisioner. De WHO Collaborating Centres for
Classification of Diseases, vilka inrättats för att
i samverkan med WHO bistå medlemsländerna
i frågor som gäller utvecklingen och
användningen av hälsorelaterade
klassifikationer och särskilt då ICD, har fått en
ny roll i detta sammanhang.
Användningen av svenska och latin
Betydelsen av att medicinska journaler så långt
möjligt utformas på svenska har understrukits
både i Socialstyrelsens s.k. språkcirkulär och i
patientjournallagen. Det har därför ansetts
viktigt att fortsätta den strävan till
försvenskning av klassifikationens språk som
inleddes med Klassifikation av sjukdomar
1987.
Medlemsländerna har möjlighet att till något
av dessa centra framföra förslag till särskilt
angelägna ändringar i ICD. Collaborating
Centres vidarebefordrar till WHO sådana
förslag som bedöms förtjäna behandling på ett
internationellt plan. Förslagen blir sedan
föremål för diskussion och beslut vid de årliga
möten som WHO anordnar tillsammans med
Collaborating Centres. Proceduren tillämpades
första gången under år 1996.
Strävan till försvenskning gäller i första hand
diagnoser på tresiffernivå och rubrikerna för
avsnitt och kapitel. På dessa nivåer finns dock
parallell latinsk text. På den mest detaljerade,
fyrställiga nivån - som motsvarar den
detaljeringsgrad som är aktuell i
journaldiagnoser och dödsbevis - använder
klassifikationen huvudsakligen ett försvenskat
latin men ibland ren svenska eller rent latin.
Målsättningen har varit att så nära som möjligt
För de nordiska länderna finns ett
Collaborating Centre vid Helsedirektoratet,
13
Vissa anvisningar för
klassifikationens användning
spegla gängse svenskt medicinskt språkbruk.
Synpunkter från kontaktpersonerna i Svenska
Läkaresällskapets olika sektioner har här varit
till stor nytta i översättningsarbetet.
Systematisk och alfabetisk förteckning
Den föreliggande systematiska
Att olika språkliga principer används på olika
nivåer i klassifikationen leder ofta till
språkväxlingar mellan nivåerna. Dessa är
konsekvenser av en strävan att erbjuda dels en
svensk terminologi, dels ett naturligt
medicinskt fackspråk i samma klassifikation.
Även på de nivåer där ett svenskt språkbruk
eftersträvats har det dock inte alltid varit
möjligt att finna goda svenska termer. I de fall
främmande ord och uttryck används på dessa
nivåer har de främmande orden oftast försetts
med en förklaring inom parentes, vilken
naturligtvis inte behöver användas när
beteckningen i fråga används i andra
sammanhang. När det gäller vilka ord och
uttryck som behöver förklaras har Svenska
Akademiens Ordlista (11 upplagan) varit till
ledning. Om en term återfinns i ordlistan har
den som regel inte förklarats ytterligare. I detta
avseende skiljer sig denna klassifikation från
sin föregångare som innehöll fler sådana
ordförklaringar.
förteckningen är den svenska versionen av
ICD-10:s ”Volume 1”. ICD-10 omfattar också
en ”Volume 2” (Instruction manual) som inte
utges i sin helhet på svenska. Den innehåller
anvisningar för klassifikationens användning
såväl för dödsorsaksstatistik som för
sjukhusbruk och andra ändamål. Sådana
anvisningar har i viss utsträckning medtagits i
denna inledning men återfinns också i en
separat publicerad handledning och annat
material speciellt inriktat på att underlätta
klassifikationens användning.
”Volume 3” (Alphabetical Index) av ICD-10
motsvaras av en svensk alfabetisk förteckning
som publiceras i en egen volym.
För att finna den korrekta koden för en viss
diagnos kan man i princip gå fram på två sätt.
Det ena är att söka sig fram i klassifikationen
med hjälp av den hierarkiska strukturen. Denna
framgår bäst av den översikt som finns i början
av boken. Man startar med det kapitel man tror
innehåller diagnosen i fråga och söker sig så
vidare till det avsnitt, den kategori och den
subkategori som enligt rubrikbeteckningarna
bör innehålla den aktuella diagnosen.
Bekräftelse på att man kommit rätt får man om
man därvid finner diagnosen själv eller en
beskrivning som väl stämmer med diagnosen i
fråga. Sökandet styrs av anvisningar av typen
Anmärkning, Innefattar och Utesluter.
Stavningsfrågor m.m.
Svenska ordböjningar och försvenskad
stavning används genomgående i de
försvenskade termerna. Härvid följs det förslag
till skrivregler för medicinska termer som
publicerats av Svenska Läkaresällskapets
kommitté för medicinsk språkvård
(Läkartidningen 1993, nr 20, sid 1965-1967).
Med denna kommitté har också vissa andra
principfrågor rörande det medicinska språket
diskuterats.
När det gäller dessa upplysningar är det viktigt
att observera deras placering. Anvisningar som
placerats i början av ett kapitel och som anger
vad som innefattas eller utesluts gäller hela
kapitlet. Motsvarande anvisningar placerade i
början av ett avsnitt gäller hela avsnittet och
sådana placerade i anslutning till en treställig
kategori gäller samtliga fyrställiga
subkategorier under denna kategori.
Kroppsdelar och organ som bara förekommer i
ental omnämns som regel i bestämd form,
medan sådana som förekommer i flertal nämns
i obestämd form.
Ordet ”och” i sjukdoms- och
skadebeteckningar ska som regel tolkas som
”och/eller”. Båda komponenterna i en
sammansatt sjukdoms- eller skadebeteckning
behöver sålunda inte samtidigt föreligga. Om
samtidig förekomst krävs används i stället
ordet ”jämte”.
Det andra sättet att finna den riktiga koden är
att utgå från den alfabetiska förteckningen.
Den innehåller särskilda anvisningar om hur
den är uppställd och bör användas. Det är
emellertid viktigt att framhålla att man i sådant
fall måste slå upp det kodnummer man med
14
särredovisats i den översikt som inleder varje
kapitel.
hjälp av det alfabetiska registret kommit fram
till i den systematiska förteckningen för att med ledning av beteckningen för kategorin i
fråga och dess inklusioner och exklusioner kontrollera att man kommit rätt. Det finns
nämligen tillfällen då man kan tro att man
funnit den rätta koden till dess man läser
igenom de uteslutningar som förekommer och
finner att det är till en av dessa man i stället
bör gå. Den alfabetiska förteckningen är
sålunda endast ett hjälpmedel och kan inte
ersätta den systematiska delen.
Asteriskkoder utgör ena delen i ett kodpar och
kan aldrig stå ensamma. De kräver alltid en
åtföljande daggerkod. Som daggerkod
förekommer dels särskilda koder som är
märkta med daggertecken i klassifikationen,
dels även andra (omärkta) koder som kan
användas som daggerkoder. Samtliga tänkbara
dagger-asterisk-kombinationer finns därför inte
angivna i klassifikationen.
Vid diagnosregistrering på sjukhus ska
asteriskkoden i ett kodpar redovisas först (till
skillnad från vad som gällde i föregående
svenska klassifikation). Den diagnos som
följer omedelbart efter en asteriskkod ska
utgöra - och tolkas alltså som - daggerkoden i
det aktuella kodparet. Detta betyder bl.a. att
om flera asteriskkoder med samma daggerkod
ska redovisas, måste var och en av
asteriskkoderna åtföljas av daggerkoden i
fråga.
Vid användning på sjukhus för patientstatistik
bör kodningen som regel ske med den största
detaljeringsgrad som är möjlig enligt denna
basklassifikation. Minst fyrställiga koder ska
användas. Om ingen uppdelning av den
treställiga kategorikoden förekommer ska den
kompletteras med decimalen 9.
Dataregistreringen underlättas av att samtliga
koder kan hanteras som minst fyrställiga.
Inom vissa kapitel finns möjlighet att göra
ytterligare uppdelningar i en femte position.
Det gäller t.ex. uppdelningen i slutna och
öppna frakturer i kapitel 19 och angivande av
aktivitetskod för skadade personer i kapitel 20.
I de specialistanpassade versionerna av
klassifikationen kan på motsvarande sätt vissa
fyrställiga subkategorier delas upp ytterligare i
en femte position (som i dessa fall är
alfabetisk).
Vid utskrift av koderna i ett sådant kodpar kan
det vara lämpligt att för tydlighets skull även
ange asterisk- och daggertecknen efter
respektive kod. Vid datorregistrering är det
dock inte nödvändigt att ta med tecknet i fråga,
eftersom asteriskkoderna är entydigt
definierade som sådana i klassifikationen.
Andra former av dubbelkodning
Dagger-asterisk-systemet
I vissa situationer kan - förutom genom
dagger-asterisk-systemet - mer än en kod
användas för att fullständigt beskriva ett visst
tillstånd. I dessa fall anges i klassifikationen att
man genom att använda en tilläggskod kan
redovisa ytterligare information.
Som redan nämnts medger dagger-asterisksystemet att vissa tillstånd kan dubbelkodas
både med avseende på sin etiologi
(daggerkoden) och med avseende på sin
manifestation eller lokalisation
(asteriskkoden). Systemet ger sålunda
information både om den underliggande
generaliserade sjukdomen och en
manifestation i ett särskilt organ eller med
särskild lokalisation, vilken i sig utgör ett
kliniskt problem som oftast handläggs inom en
annan specialitet än grundsjukdomen.
Detta förekommer t.ex. med avseende på
lokala infektioner som klassificeras i något av
de organsystemrelaterade kapitlen, där koder
från blocket B95-B98 i kapitel 1 kan användas
för att ange den infektiösa organismen.
På motsvarande sätt kan funktionell aktivitet
hos tumörer anges genom att den relevanta
koden från kapitel 4 används i tillägg till
tumörkoden.
Asteriskkoderna finns samlade inom 83
särskilda treställiga koder, flertalet av dem
uppdelade i subkategorier. Vilka de är får man
enklast en uppfattning om genom att de
15
läkemedelsförgiftningarnas natur berörs i nästa
avsnitt.
Vid organiska, inklusive symtomatiska,
psykiska störningar (avsnitt F00-F09) kan en
kod från ett annat kapitel användas som
tilläggskod för att ange orsaken, t.ex. en
underliggande sjukdom eller skada. I detta
avsnitt finns också ett par dagger-asterisklösningar av motsvarande innebörd.
Skadans uppkomstsätt klassificeras i kapitel 20
som avser yttre orsaker till sjukdom och död.
Koder från kapitel 19 ska alltid åtföljas av en
kod från kapitel 20, vilken vid patientstatistik
på sjukhus som regel registreras i ett särskilt
fält.
I de fall ett tillstånd har orsakats av ett toxiskt
ämne kan en kod från kapitel 20 användas som
tilläggskod för att ange ämnet i fråga.
Motsvarande gäller också för
läkemedelsutlösta tillstånd men här tillämpas
speciella regler (se mera härom nedan).
Kapitel 20 är i ICD-10 till vissa delar mycket
detaljrikt. I klinisk rutinverksamhet föreligger
ofta inte så detaljerad information att det är
möjligt att utnyttja detaljrikedomen
beträffande uppkomstsättet för t.ex.
transportolyckor. I den svenska
klassifikationen erbjuds därför i dessa fall en
möjlighet till förenklad användning av
kodsystemet som innebär att man endast
utnyttjar den minst preciserade koden inom en
grupp av inbördes relaterade koder. Så kan
t.ex. vid cykelolyckor koden V19 med
tillämpliga decimaler ersätta de mer
detaljerade koderna V10-V18 vid förenklad
kodning. För att tydliggöra denna möjlighet
har motsvarande avsnitt i klassifikationen fått
en avvikande typografisk utformning.
Alla tillstånd som klassificeras i kapitel 19 ska
åtföljas av en kod från kapitel 20 som
beskriver skadans uppkomstsätt. (Detta
överensstämmer med användningen av de s.k.
E-numren i den föregående klassifikationen.)
Detta beskrivs närmare i följande avsnitt.
Kodning av skador och förgiftningar
Dubbelklassificeringen av skador och
förgiftningar syftar till att möjliggöra statistik
baserad på två olika aspekter, nämligen både
skadans natur och dess uppkomstsätt. Den
kliniska diagnosen beskriver som regel
skadans natur (t.ex. en viss typ av fraktur,
sårskada eller förgiftning). Statistik över
skadornas natur speglar vilka typer av
sjukvårdsinsatser som varit aktuella och
därmed resursutnyttjandet. Sådan statistik är
däremot mindre användbar för förebyggande
insatser; här är statistik över skadornas
uppkomstsätt mer angelägen (t.ex. skada
genom cykelolycka, fall från
byggnadsställning, självmordsförsök).
Vid specialstudier med inriktning på
olycksprevention kan självfallet de mer
detaljerade koderna användas. Ett alternativ i
sådana fall är den särskilda nordiska
klassifikationen för registrering av
olycksfallsskador.
Inverkan av läkemedel
När det gäller inverkan av droger, läkemedel
och biologiska substanser skiljer man på
följande två huvudtyper:
• förgiftning genom överdosering
• ogynnsam inverkan av en adekvat substans
som ordinerats och givits på rätt sätt
Skadans natur klassificeras i kapitel 19. Som
framgår av inledningen till detta kapitel bör där så är möjligt - multipla, d.v.s.
sammansatta, skador registreras med separata
koder för de olika skadorna.
Kombinationskoder för multipla skador avser
fall där det inte finns tillräckligt med detaljer
för att karakterisera varje enskilt tillstånd eller
för sådan statistisk redovisning där det är
lämpligt att redovisa en enda kod. Vid öppen
fraktur kan man som ett alternativ till att
registrera frakturen och sårskadan i separata
koder utnyttja en undergruppering i
frakturkodens femte position som gör det
möjligt att skilja på slutna och öppna frakturer.
De särskilda reglerna för att koda
Förgiftningar med läkemedel klassificeras med
avseende på skadans natur i första hand genom
ett kodnummer i serien T36-T50 (eller koden
T50.9 åtföljd av motsvarande ATC-kod; se
härom nedan). Denna kod (dessa koder) för
förgiftningen anges som huvuddiagnos och blir
som regel den enda kod (de enda koder) som
beskriver skadans natur. Det är dock möjligt
att som tilläggskod ange manifestationer som
innebär betydande vårdproblem, t.ex. djup
medvetslöshet som kräver vård på
16
den svenska klassifikationen en möjlighet till
förenklad användning av de nyssnämnda
koderna från kapitel 20. Eftersom läkemedlet i
fråga redan specificerats i koden från kapitel
19 (eller genom motsvarande ATC-kod), kan
koden från kapitel 20 förenklas genom att man
endast utnyttjar den minst preciserade koden i
den aktuella kodserien, nämligen Y57.9. För
att tydliggöra denna möjlighet har motsvarande
avsnitt i klassifikationen också i detta fall fått
en avvikande typografisk utformning.
intensivvårdsavdelning; i detta fall kan
medvetslöshet (R40.2) anges som tilläggskod.
Hur överdoseringen skett specificeras genom
den kod från kapitel 20 som enligt vad som
tidigare sagts alltid ska åtfölja en diagnos
avseende skador och förgiftningar. Här kan
man skilja på oavsiktlig förgiftning, d.v.s.
förgiftning genom olyckshändelse (X40-X44),
avsiktligt självtillfogad förgiftning, t.ex.
självmordsförsök (X60-X64), övergrepp av
annan person genom förgiftning, t.ex.
mordförsök (X85). Vid läkemedelsförgiftning
med oklar avsikt – d.v.s. i fall där
informationen är otillräcklig för att avgöra om
förgiftningen uppkommit genom
olyckshändelse, om den är självtillfogad eller
av annan person avsiktligt tillfogad - kan detta
anges genom kod i serien Y10-Y14.
Användningen av ATC-koder för
läkemedel
Erfarenheten har visat att det vid registrering
av förgiftningar och ogynnsam effekt av
läkemedel många gånger är angeläget med en
mer detaljerad beskrivning av det aktuella
läkemedlet än vad ICD:s koder medger. Därtill
kommer att utvecklingen av nya läkemedel
sker så snabbt att klassifikationens förteckning
över läkemedel inom kort tid kan bli inaktuell.
I likhet med vad fallet var i föregående
klassifikation ges därför i den svenska
klassifikationen möjlighet att använda mer
preciserade läkemedelskoder än de som anges i
kodserien T36-T50.
I den svenska klassifikationen erbjuds en
möjlighet till förenklad användning av de
nyssnämnda koderna från kapitel 20. Eftersom
läkemedlet i fråga redan specificerats i koden
från kapitel 19 (T36-T50) (eller genom koden
T50.9 åtföljd av ATC-kod; se härom nedan),
kan koden från kapitel 20 förenklas genom att
man endast utnyttjar den minst preciserade
koden i de nyssnämnda kodserierna, nämligen
X44, X64 respektive Y14. För att tydliggöra
denna möjlighet har motsvarande avsnitt i
klassifikationen fått en avvikande typografisk
utformning
För detta används de s.k. ATC-koder som
återfinns i senaste upplagan av ”FASS:
Läkemedel i Sverige”. ATC står för
Anatomical Therapeutic Chemical
Classification System och är ett
läkemedelskodningssystem som utvecklats och
används i de nordiska länderna. ATC-systemet
används också i WHO:s internationella
rapportering av biverkningar. Systemet
rekommenderas av WHO även för redovisning
av läkemedelsanvändning.
Ogynnsamma effekter av läkemedel som
administrerats på rätt sätt i terapeutiskt eller
profylaktiskt syfte utgörs t.ex. av
överkänslighetsreaktioner eller andra
biverkningar. I dessa fall ska den ogynnsamma
effekten anges som huvuddiagnos, medan det
orsakande läkemedlet specificeras genom
tilläggskod. Exempel på ogynnsam effekt kan
vara blodsjukdom (D50-D76), dermatit på
grund av intagen substans (L27), gastrit
orsakad av acetylsalicylsyra (K29),
kontaktdermatit (L23-L25), nefropati (N14.0N14.2). En icke närmare specificerad
läkemedelsreaktion får koden T88.7. I detta
fall anges det orsakande läkemedlet som
tilläggskod genom läkemedelskod från serien
T36-T50 (eller motsvarande ATC-kod).
ATC-koderna är alfanumeriska och sjuställiga.
De karakteriseras av att i fjärde positionen
alltid ha en bokstav, vilket gör det möjligt att
skilja dem från ICD-10-koder som har en
liknande struktur. (För att undvika förväxling
av koder måste därför såväl ICD-10-koder som
ATC-koder alltid registreras med minst fyra
tecken.)
Om mer än ett läkemedel varit aktuellt vid en
förgiftning redovisas samtliga, varvid det
kliniskt viktigaste anges först. I de fall ett
läkemedel inte finns angivet med ATC-kod i
FASS, t.ex. vid ex tempore-beredningar, eller
vid ofullständiga uppgifter om orsakande
Uppkomstsättet måste dessutom anges med
hjälp av en kod i kapitel 20 hämtad från
kodserien Y40-Y57. Även i detta fall erbjuder
17
substans används i stället kodnummer från
serien T36-T50.
arbete och har sålunda också betydelse för
olyckspreventionen.
Användningen av kapitel 20
Det är viktigt att platskoden och
aktivitetskoden inte blandas samman och att de
registreras i rätta positioner. Om uppgift
saknas om plats för den yttre orsakens
inverkan kan man inte lämna fjärdepositionen
blank eller i stället ange aktivitetskod där. I
sådana fall måste koden för ospecificerad plats
(.9) anges i fjärdepositionen, varvid en
eventuellt tillämplig aktivitetskod kommer att
registreras i femtepositionen.
Som framgått tidigare ska koder från kapitel 19
alltid åtföljas av kod från kapitel 20 som anger
den yttre orsaken till skadan, förgiftningen
eller annat tillstånd som klassificeras i kapitel
19. Även andra tillstånd som uppfattas ha en
yttre orsak men som klassificeras i något av
kapitlen 1-18 kan kombineras med kod från
kapitel 20.
Om flera yttre orsaker samtidigt är aktuella
anges den orsak som hänför sig till den
allvarligaste skadan, d.v.s. huvuddiagnosen,
först. I normala fall bör det räcka med
möjlighet att ange två samtidiga koder från
kapitel 20.
Användningen av kapitel 21
Kapitel 21 avser faktorer av betydelse för
hälsotillståndet och för kontakter med hälsooch sjukvården. Det motsvaras av den tidigare
tilläggsklassifikationen som kallades V-serien.
Antalet koder har emellertid utökats betydligt.
Vissa möjligheter till förenklad användning av
de detaljerade koderna i kapitel 20 för
transportolyckor och vid inverkan av
läkemedel har berörts ovan. I vissa andra fall
kan det synas som om den samtidiga
användningen av koder från kapitel 19 och 20
inte innebär att någon ny information tillförs.
Av principiella skäl och för enhetlighetens
skull ska man dock även i dessa fall ange
koder från båda kapitlen.
I detta kapitel finns kategorier som lämpar sig
för att registrera orsaker till kontakter med
sjukvården i speciella syften såsom för
hälsokontroll eller profylaktiska åtgärder utan
att någon diagnos registreras eller av
administrativa skäl, t.ex. utfärdande av intyg.
Efterundersökning av till synes friska personer
efter tidigare behandling för maligna eller
andra sjukdomar kan också registreras här
liksom friska smittbärare. Denna typ av
orsaker till kontakter är oftast aktuella som
enda kod för ett öppenvårdsbesök.
Det bör påpekas att i inledningen till kapitel 20
återfinns en platskod. Denna har formen av en
fjärdepositionsuppdelning och bör användas
tillsammans med flertalet koder i detta kapitel
(kategorierna W00-Y34 med undantag för Y06
och Y07). Platskoden används dock inte
tillsammans med koder avseende
transportolyckor eller för komplikationer vid
medicinsk vård och kirurgiska åtgärder. I dessa
fall är platskoden mindre relevant och
fjärdepositionen används i stället för andra
preciseringar. Platskoden ger t.ex. möjlighet att
skilja ut olyckor som inträffat i hemmet, en
upplysning som kan vara av betydelse i det
olycksförebyggande arbetet.
Koder finns också för att registrera sådant som
har väsentlig betydelse för patientens
hälsotillstånd eller vård utan att detta utgör
aktuell sjukdom eller skada. Här kan sålunda
vissa potentiella hälsorisker noteras såsom
socioekonomiska och psykosociala
riskfaktorer, yrkesmedicinska exponeringar
och förhållanden i familjeanamnesen eller den
personliga anamnesen av betydelse för
framtida kontakter med hälso- och sjukvården.
I dessa fall är det oftast fråga om förhållanden
som det finns anledning att registrera i tillägg
till andra tillstånd. Självklart är det endast
förhållanden med särskild betydelse i det
enskilda fallet och vid det aktuella vårdtillfället
eller öppenvårdsbesöket som bör registreras.
Avsikten är inte att med hjälp av dessa koder
ge en beskrivning av en persons allmänna
livssituation.
En aktivitetskod återfinns också i ingressen till
kapitel 20. Den beskriver aktiviteten hos den
skadade personen vid tiden för den yttre
orsakens inverkan och är avsedd att användas
som en femtepositionsuppdelning av
kategorierna V01-Y34 i tillämpliga fall.
Aktivitetskoden gör det möjligt att statistiskt
särredovisa t.ex. idrottsolyckor och olycksfall i
18
av tillstånden som huvuddiagnos. För
patientstatistik vid sjukhus gäller att som
huvuddiagnos definierar man det tillstånd för
vilket patienten huvudsakligen utretts eller
behandlats under sjukhusvistelsen. Härvid
använder man den diagnosformulering som
man kommit fram till vid vårdtillfällets slut
(och alltså inte den ofta preliminärt
formulerade intagningsdiagnosen). Om någon
sjukdomsdiagnos inte ställts, gäller att det
viktigaste symtomet eller problemet under
vårdtillfället väljs som huvuddiagnos.
Härutöver bör i patientjournalen anges de
andra tillstånd eller problem som blivit föremål
för utredning eller behandling under
vårdtillfället som bidiagnoser.
Vilka diagnoser ska registreras på
sjukhus?
För registrering i ett diagnosregister finns det i
princip ingen gräns för hur många diagnoser
som kan tas med för varje vårdad person. Inte
minst praktiska synpunkter talar dock för en
begränsning av antalet.
Endast sådana diagnoser som haft relevans för
vården bör registreras. Om en diagnos har
föranlett utredning eller någon form av
behandling bör den registreras, eljest inte.
(Denna regel är dock knappast tillämplig inom
långtidssjukvård där patienter under mycket
långa vårdtider hinner bli föremål för många
utredningar och behandlingar. Här blir det i
många fall aktuellt att göra ett urval av de
viktigaste diagnoserna.) Oväsentliga bifynd,
tidigare behandlade och till synes utläkta
sjukdomar bör ej tas med, såvida de inte haft
betydelse för utredningen eller behandlingen.
Det tillstånd som tagit mest sjukvårdsresurser i
anspråk bör väljas som huvuddiagnos om mer
än ett tillstånd kan komma i fråga som
huvuddiagnos. Det kan t.ex. vara fallet om en
patient intas för vård för ett tillstånd och
vårdtiden förlängs på grund av nödvändigheten
att utreda eller behandla ett annat tillstånd som
uppträder eller upptäcks under
sjukhusvistelsen.
De symtomdiagnoser som finns samlade i
kapitel 18 - men som i viss utsträckning också
återfinns i organsystemkapitlen - bör som regel
inte användas för att ytterligare precisera eller
komplettera redan säkra diagnoser.
Symtomdiagnoserna är i första hand avsedda
för sådana fall där någon definitiv diagnos inte
kan ställas.
Vid tillstånd som dubbelkodas med daggerasterisk-systemet är det diagnosparet i fråga
som anges som huvuddiagnos. Av praktiska
skäl anges emellertid asteriskdiagnosen först
inom paret såsom tidigare nämnts. Vid
skadefall hämtas huvuddiagnosen från kapitel
19 avseende skadans natur. Tillhörande kod
från kapitel 20 avseende skadans uppkomstsätt
kan ses som en dubbelkod.
Vid sjukhusbruk kan det vara motiverat att
registrera båda de komponenter som ingår i ett
kombinationsnummer. Vid ischemisk
hjärtsjukdom (I20-I25) och cerebrovaskulär
sjukdom (I60-I69) bör sålunda en samtidig
hypertoni registreras med särskild kod
avseende hypertonin (I10-I15), även om
koderna för ischemisk hjärtsjukdom och
cerebrovaskulär sjukdom anges innefatta
förekomst av hypertoni.
Vid vårdtillfällen som gäller flera sinsemellan
relaterade, multipla tillstånd (t.ex. multipla
skador, multipla sena effekter, multipla
komplicerande tillstånd vid HIV-infektion)
gäller att man om möjligt bör koda varje
ingående komponent separat och som
huvuddiagnos välja det tillstånd som varit
allvarligast och tagit mest sjukvårdsresurser i
anspråk. Om inget av tillstånden dominerar
bilden, kan man i stället ange någon av de
särskilda koderna för multipla tillstånd som
huvuddiagnos och därefter ange de ingående
komponenterna med egna koder som
bidiagnoser.
När det gäller multipla tillstånd, t.ex. multipla
skador för vilka det finns särskilda koder i
kapitel 19, bör man vid sjukhusbruk registrera
de ingående skadekomponenterna där så är
möjligt.
Val av huvuddiagnos
Även om det sålunda är möjligt och lämpligt
att registrera flera diagnoser vid ett och samma
vårdtillfälle, är det för statistiska översikter och
för vissa andra syften nödvändigt att ange ett
Oklara diagnoser
Säkerheten i de medicinska diagnoserna
varierar och klassifikationen innehåller som
19
regel inte några kriterier för de angivna
diagnoserna. Ett undantag utgör i detta
avseende diagnoserna i kapitel 5 Psykiska
sjukdomar och syndrom samt
beteendestörningar. I detta kapitel finns för
flertalet diagnoser beskrivningar av den
kliniska bilden vilket underlättar en enhetlig
diagnossättning.
ICD-10 erbjuder ett antal kategorier för sena
effekter (B90-B94, E64, E68, G09, I69, O94,
O97, T90-T98, Y85-Y89). Dessa koder kan
användas för att ange förekomsten av tillstånd
som inte längre är för handen men som orsakat
ett aktuellt problem som är föremål för
utredning eller behandling. I dessa fall är det
dock det aktuella problemet som bör anges
som huvuddiagnos. Koden för sena effekter
används i dessa fall som tillägg till den kod
som beskriver det aktuella resttillståndet. När
det gäller sena effekter av skador bör koderna
T90-T98 åtföljas av koder från kapitel 20 i
serien Y85-Y89.
Fall där diagnosen stöds av symtom och
observerade sjukdomstecken och där
misstanken kvarstår efter utredning, trots att
diagnosen inte kunnat slutligt fastställas, anges
ibland i patientjournalen med ett frågetecken
inom parentes. Detta frågetecken kan som
regel inte komma till uttryck i koden.
Diagnoser som på det ena eller andra sättet
markerats som osäkra skiljer sig emellertid
ofta inte i princip - utan främst beträffande
graden av osäkerhet - från andra diagnoser. De
bör därför kodas som om inget frågetecken
fanns.
För att avgöra vad som ska anses vara sena
effekter anges ibland i ICD-10 att detta gäller
tillstånd som medicinskt betecknas som ”sena”
eller som kvarstår (och föranlett behandling
eller intagning på sjukhus) ett år eller mer efter
det ursprungliga insjuknandet eller den akuta
skadan. Denna tidsangivelse är dock att anse
som en hjälpregel. Något krav på att minst ett
år ska ha förflutit finns inte, om tillståndet
kliniskt betraktas som en ”sen” effekt.
Vid större osäkerhet om diagnosen bör man
klassificera fallet på det symtom eller det
onormala fynd som föranlett utredning eller
vård. Här är det i första hand fråga om koder i
kapitel 18. Det är fel att vid osäkerhet om
diagnosen registrera flera alternativa osäkra
diagnoser.
Kodning av komplikationer
En nyhet i ICD-10 är det utökade antalet
kategorier för tillstånd som uppstått efter
kirurgiska eller medicinska ingrepp, t.ex.
postoperativa komplikationer. Förutom
kodserien T80-T88 i kapitel 19 finns i flera
organsystemkapitel särskilda kategorier för
tillstånd som uppträder antingen som följd av
vissa specifika åtgärder och tekniker eller som
resultat av borttagande av ett organ (E89, G97,
H59, H95, I97, J95, K91, M96, N99). Vissa
tillstånd (t.ex. pneumoni och lungemboli) som
kan uppstå i den postoperativa perioden
uppfattas inte som unika, utan kodas på vanligt
sätt. I dessa fall kan dock en kod från serien
Y83-Y84 i kapitel 20 användas som
tilläggskod för att ange relationen till åtgärden.
Om en patient observerats eller utretts för
misstänkt sjukdom eller symtom och
misstanken efter utredningen kunnat avföras
och patienten inte visats vara i behov av
ytterligare vård eller behandling, registreras
fallet lämpligen med de särskilda koder som
finns för denna typ av observations- och
utredningsfall i kapitel 21 (Z03).
Följdtillstånd och sena effekter
I praktisk medicinsk verksamhet förekommer
inte sällan s.k. status post-diagnoser för att
markera följdtillstånd till och sena effekter av
sjukdom, skada eller operation. Dessa
diagnoser kan vålla svårigheter vid kodningen.
20
Översiktlig förteckning över innehållet i
sjukdomsklassifikationens kapitel
Kapitel 1. Vissa infektionssjukdomar och parasitsjukdomar (A00-B99)
Infektionssjukdomar utgående från mag-tarmkanalen (A00-A09)
Tuberkulos (A15-A19)
Vissa djurburna bakteriesjukdomar (A20-A28)
Andra bakteriesjukdomar (A30-A49)
Huvudsakligen sexuellt överförda infektioner (A50-A64)
Andra spiroketsjukdomar (A65-A69)
Andra sjukdomar orsakade av klamydia (A70-A74)
Sjukdomar orsakade av rickettsiaarter (A75-A79)
Virussjukdomar i centrala nervsystemet (A80-A89)
Febersjukdomar orsakade av virus överförda av leddjur och virusorsakade hemorragiska febrar
(A92-A99)
Virussjukdomar med hudutslag och slemhinneutslag (B00-B09)
Virushepatit(B15-B19)
Sjukdom orsakad av humant immunbristvirus [HIV] (B20-B24)
Andra virussjukdomar (B25-B34)
Svampsjukdomar (B35-B49)
Protozosjukdomar (B50-B64)
Masksjukdomar (B65-B83)
Lusangrepp, acarinos och andra infestationer (B85-B89)
Sena effekter av infektionssjukdomar och parasitsjukdomar (B90-B94)
Bakterier, virus och andra infektiösa organismer (B95-B98)
Andra infektionssjukdomar (B99-B99)
Kapitel 2. Tumörer (C00-D48)
Maligna tumörer med specificerad lokalisation, som konstaterats vara eller förmodats vara primära.
Undantag är dock tumörer i lymfoid, blodbildande och därmed besläktad vävnad (C00-C75)
Maligna tumörer i läpp, munhåla och svalg (C00-C14)
Malign tumör i matsmältningsorganen (C15-C26)
Malign tumör i andningsorganen och brösthålans organ (C30-C39)
Maligna tumörer i ben och ledbrosk (C40-C41)
Melanom och andra maligna tumörer i huden (C43-C44)
Maligna tumörer i mesotelial vävnad och mjukvävnad (C45-C49)
Malign tumör i bröstkörtel (C50-C50)
Maligna tumörer i de kvinnliga könsorganen (C51-C58)
Maligna tumörer i de manliga könsorganen (C60-C63)
Maligna tumörer i urinorganen (C64-C68)
Maligna tumörer i öga, hjärnan och andra delar av centrala nervsystemet (C69-C72)
Maligna tumörer i tyreoidea och andra endokrina körtlar (C73-C75)
Maligna tumörer med ofullständigt angivna, sekundära och ospecificerade lokalisation (C76-C80)
Maligna tumörer i lymfatisk, blodbildande och besläktad vävnad (C81-C96)
Flera (primära) maligna tumörer med olika ursprung (C97-C97)
Cancer in situ (D00-D09)
Benigna tumörer (D10-D36)
Tumörer av osäker eller okänd natur (D37-D48)
21
Kapitel 3. Sjukdomar i blod och blodbildande organ samt vissa rubbningar i
immunsystemet (D50-D89)
Nutritionsanemier (D50-D53)
Hemolytiska anemier (D55-D59)
Aplastisk anemi och andra anemier (D60-D64)
Koagulationsrubbningar, purpura och andra blödningstillstånd (D65-D69)
Andra sjukdomar i blod och blodbildande organ (D70-D77)
Vissa rubbningar i immunsystemet (D80-D89)
Kapitel 4. Endokrina sjukdomar, nutritionsrubbningar och
ämnesomsättningssjukdomar (E00-E90)
Sjukdomar i sköldkörteln (E00-E07)
Diabetes (E10-E14)
Andra rubbningar i glykosreglering och bukspottkörtelns inre sekretion (E15-E16)
Sjukdomar i andra endokrina körtlar (E20-E35)
Näringsbrist (E40-E46)
Andra näringsbristtillstånd (E50-E64)
Fetma och andra övernäringstillstånd (E65-E68)
Ämnesomsättningssjukdomar (E70-E90)
Kapitel 5. Psykiska sjukdomar och syndrom samt beteendestörningar
(F00-F99)
Organiska, inklusive symtomatiska, psykiska störningar (F00-F09)
Psykiska störningar och beteendestörningar orsakade av psykoaktiva substanser (F10-F19)
Schizofreni, schizotypa störningar och vanföreställningssyndrom (F20-F29)
Förstämningssyndrom (F30-F39)
Neurotiska, stressrelaterade och somatoforma syndrom (F40-F48)
Beteendestörningar förenade med fysiologiska rubbningar och fysiska faktorer (F50-F59)
Personlighetsstörningar och beteendestörningar hos vuxna (F60-F69)
Psykisk utvecklingsstörning (F70-F79)
Störningar i psykisk utveckling (F80-F89)
Beteendestörningar och emotionella störningar med debut vanligen under barndom och ungdomstid
(F90-F98)
Ospecificerad psykisk störning (F99-F99)
Kapitel 6. Sjukdomar i nervsystemet (G00-G99)
Inflammatoriska sjukdomar i centrala nervsystemet (G00-G09)
Systemiska atrofier som primärt engagerar centrala nervsystemet (G10-G14)
Basalgangliesjukdomar och rörelserubbningar (G20-G26)
Andra degenerativa sjukdomar i nervsystemet (G30-G32)
Myelinförstörande sjukdomar i centrala nervsystemet (G35-G37)
Episodiska och paroxysmala sjukdomar (G40-G47)
Sjukdomar i nerver, nervrötter och nervplexus (G50-G59)
Polyneuropatier och andra sjukdomar i perifera nervsystemet (G60-G64)
Neuromuskulära transmissionsrubbningar och sjukdomar i muskler (G70-73)
Cerebral pares och andra förlamningssyndrom (G80-G83)
Andra sjukdomar i nervsystemet (G90-G99)
22
Kapitel 1
Vissa infektionssjukdomar och
parasitsjukdomar (A00-B99)
Aliqui morbi infectiosi et parasitarii
Innefattar:
Sjukdomar som i allmänhet uppfattas som smittsamma eller överförbara
Utesluter:
Bärare eller misstänkt bärare av agens för infektionssjukdom (Z22.-)
Infektionssjukdomar och parasitsjukdomar, som komplikation till graviditet, förlossning och
barnsängstid (med undantag för obstetrisk tetanus och orsak av humant immunbristvirus [HIV])
(O98.-)
Infektionssjukdomar och parasitsjukdomar, specifika för perinatalperioden (med undantag för
tetanus neonatorum, kikhosta, medfödd syfilis, perinatal gonokockinfektion och perinatal sjukdom
orsakad av humant immunbristvirus [HIV]) (P35-P39)
Influensa och andra akuta luftvägsinfektioner (J00-J22)
Vissa lokaliserade infektioner - se kapitel för respektive organsystem
Anmärkning:
Tilläggskod (U80-U89) kan användas för att ange resistens mot antimikrobiella läkemedel
Detta kapitel innehåller följande avsnitt:
A00-A09 Infektionssjukdomar utgående från mag-tarmkanalen
A15-A19 Tuberkulos
A20-A28 Vissa djurburna bakteriesjukdomar
A30-A49 Andra bakteriesjukdomar
A50-A64 Huvudsakligen sexuellt överförda infektioner
A65-A69 Andra spiroketsjukdomar
A70-A74 Andra sjukdomar orsakade av klamydia
A75-A79 Sjukdomar orsakade av rickettsiaarter
A80-A89 Virusinfektioner i centrala nervsystemet
A92-A99 Febersjukdomar orsakade av virus överförda av leddjur och virus orsakade
hemorragiska febrar
B00-B09 Virusinfektioner med hud- och slemhinneutslag
B15-B19 Virushepatit
B20-B24 Sjukdom orsakad av humant immunbristvirus [HIV]
B25-B34 Andra virussjukdomar
B35-B49 Svampsjukdomar
B50-B64 Protozosjukdomar
B65-B83 Masksjukdomar
23
B85-B89
B90-B94
B95-B98
B99
Lusangrepp, angrepp av kvalsterarter och andra infestationer
Sena effekter av infektionssjukdomar och parasitsjukdomar
Bakterier, virus och andra infektiösa organismer
Andra infektionssjukdomar
INFEKTIONSSJUKDOMAR UTGÅENDE
FRÅN MAG-TARMKANALEN (A00-A09)
A02
Aliae salmonelloses
Morbi infectiosi origine gastrointestinali
A00
Innefattar:
Infektion eller matförgiftning orsakad av
salmonellaarter andra än Salmonella
typhi och Salmonella paratyphi
Kolera
Cholera
A00.0
Kolera orsakad av Vibrio cholerae 01,
biovar cholerae
Klassisk kolera
A00.1
Kolera orsakad av Vibrio cholerae 01,
biovar el tor
Andra salmonellainfektioner
A02.0
Salmonellaenterit
A02.1
Salmonellasepsis
A02.2†
Lokaliserade salmonellainfektioner
Kolera El Tor
Salmonellos
Renal tubulo-interstitiell sjukdom
orsakad av salmonella (N16.0*)
Salmonellaartrit (M01.3*)
Salmonellameningit (G01*)
Salmonellaosteomyelit (M90.2*)
Salmonellapneumoni (J17.0*)
A00.9
Kolera, ospecificerad
A01
Tyfoidfeber och
paratyfoidfeber
A02.8
Febris typhoides et febris
paratyphoides
Andra specificerade
salmonellainfektioner
A02.9
Andra salmonellainfektioner,
ospecificerade
A01.0
Tyfoidfeber
A01.1
Paratyfoidfeber A
A01.2
Paratyfoidfeber B
A01.3
Paratyfoidfeber C
A01.4
Paratyfoidfeber, ospecificerad
Salmonellainfektion UNS
Infektion orsakad av Salmonella typhi
A03
Shigellos (bakteriell dysenteri,
rödsot)
Shigellosis
Infektion orsakad av Salmonella
paratyphi UNS
24
A03.0
Shigella dysenteriae (serogrupp A)
A03.1
Shigella flexneri (serogrupp B)
A03.2
Shigella boydii (serogrupp C)
A03.3
Shigella sonnei (serogrupp D)
A03.8
Annan specificerad shigellos
A03.9
Shigellos, ospecificerad
Shiga-Kruse-dysenteri
Bacillär dysenteri UNS
A04
Andra bakteriella
tarminfektioner
A05
Aliae infectiones bacteriales
intestinales
Annan matförgiftning orsakad
av bakterier som ej
klassificeras på annan plats
Alia intoxicatio alimentaria
bacterialis non alibi classificata
Utesluter:
Matförgiftning som klassificeras på
annan plats
Tuberkulös enterit (A18.3)
Utesluter:
Infektion orsakad av Escherichia coli
(A04.0-A04.4)
Listerios (A32.-)
Matförgiftning och infektion orsakad av
Clostridium difficele (A04.7)
Matförgiftning och infektion orsakad av
salmonella (A02.-)
Matförgiftning av skadlig föda (T61T62)
A04.0
Infektion med tarmpatogena
Escherichia coli-bakterier
A04.1
Infektion med tarmtoxiska
Escherichia coli-bakterier
A04.2
Infektion med tarminvasiva
Escherichia coli-bakterier
A05.0
Matförgiftning orsakad av
stafylokocker
A04.3
Infektion med tarmhemorragiska
Escherichia coli-bakterier
A05.1
Botulism
A05.2
Matförgiftning orsakad av
Clostridium perfringens [Clostridium
welchii]
A04.4
Annan tarminfektion med
Escherichia coli
Escherichia coli-enterit UNS
A04.5
Enterit orsakad av Campylobacter
A04.6
Enterit orsakad av Yersinia
enterocolitica
A04.7
Enteritis necroticans
A05.3
Utesluter:
Extraintestinal yersinios (A28.2)
Matförgiftning orsakad av Vibrio
parahaemolyticus
A05.4
Enterokolit orsakad av Clostridium
difficile
Matförgiftning orsakad av Bacillus
cereus
A05.8
Andra specificerade matförgiftningar
orsakade av bakterier
A05.9
Matförgiftning orsakad av bakterier,
ospecificerad
A06
Amöbainfektion
Matförgiftning orsakad av Clostridium
difficile
Pseudomembranös kolit
Toxisk effekt orsakad av Clostridium
difficile
A04.8
A04.9
Matförgiftning orsakad av Clostridium
botulinum
Andra specificerade bakteriella
tarminfektioner
Amoebiasis
Bakteriell tarminfektion,
ospecificerad
Innefattar:
Infektioner orsakade av Entamoeba
histolytica
Bakteriell enterit UNS
Utesluter:
Andra protozosjukdomar i tarmen
(A07.-)
25
A06.0
Akut amöbadysenteri
A06.1
Kronisk intestinal amöbainfektion
Akut amoebiasis
Intestinal amöbainfektion UNS
A06.2
Kolit orsakad av amöba
A06.3
Amöbom i tarmen
A06.4
Leverabscess orsakad av amöba
A06.5†
Lungabscess orsakad av amöba
A06.6†
A07.9
Kolit, diarré och dysenteri orsakad av
protozoer
Amöbom UNS
A08
Hepatisk amoebiasis
Abscess i lunga (och lever) orsakad av
amöba (J99.8*)
Abcess i lunga (och lever) med
pneumoni orsakad av amöba (J17.3*)
A06.8
Utesluter:
Influensa med gastrointestinalt
engagemang (J09, J10.8-J11.8)
Hjärnabscess orsakad av amöba
(G07*)
Sårbildning i huden orsakad av
amöba
Amöbaappendicit
Amöbabalanit† (N51.2*)
Amöbainfektion, ospecificerad
A07
Andra protozosjukdomar i
tarmen
Alii morbi protozoici intestinales
A07.0
Balantidiasis
Dysenteri orsakad av Balantidium coli
A07.1
Giardiasis
A07.2
Infektion orsakad av
Cryptosporidium
A08.0
Enterit orsakad av rotavirus
A08.1
Akut gastroenteropati orsakad av
norovirus
Enterit orsakad av norovirus
Enterit orsakad av ”small round
structured virus”
Amöbainfektion med annan
lokalisation
A06.9
A08.2
Enterit orsakad av adenovirus
A08.3
Enterit orsakad av annat specificerat
virus
A08.3A
Coxsackievirusenterit
A08.3B
ECHO-virusenterit
A08.3W
Enterit orsakad av annat specificerat
virus
A08.4
Enterit orsakad av ospecificerat virus
A08.5
Andra specificerade tarminfektioner
Lambliasis
Kryptosporidios
A07.3
Isosporiasis
A07.8
Andra specificerade tarmsjukdomar
orsakade av protozoer
Tarminfektioner orsakade av
virus och andra specificerade
organismer
Infectiones intestinales e viris et
aliis organismis specificatis
Abscess i hjärna (och lever) (och lunga)
orsakad av amöba
A06.7
Protozosjukdom i tarmen,
ospecificerad
Infektion orsakad av Isospora belli och
Isospora hominis
Intestinal coccidios
Intestinal trikomonasinfektion
Sarkocystos
Sarkosporidios
26
Virusenterit UNS
Virusgastroenterit UNS
Virusgastroenteropati UNS
A09
TUBERKULOS (A15-A19)
Annan gastroenterit och kolit
av infektiös och ospecificerad
orsak
Tuberculosis
Innefattar:
Infektioner orsakade av Mycobacterium tuberculosis
och Mycobacterium bovis
Alia gastroenteritis et colitis
causae infectiosae et non
specificatae
Utesluter:
Icke infektiös diarré (K52.9)
Icke infektiös diarré hos nyfödd (P78.3)
Om sjukdomen orsakas av bakterier,
protozoer, virus och andra infektiösa
organismer (A00-A08)
A09.0
A15
Annan och ospecificerad gastroenterit
och kolit av infektiös orsak
Diarré:
• akut hemorragisk
• akut vattnig
• dysenterisk
• epidemisk
• infektiös UNS
Enterit, hemorragisk, septisk eller UNS
Gastroenterit, hemorragisk, septisk eller
UNS
Kolit, hemorragisk, septisk eller UNS
A09.9
Utesluter:
HIV-infektion med tuberkulos (B20.0)
Medfödd tuberkulos (P37.0)
Pneumokonios förenad med tuberkulos (J65)
Sena effekter av tuberkulos (B90.-)
Silikotuberkulos (J65)
Gastroenterit och kolit av
ospecificerad orsak
Tuberkulos i andningsorganen,
bakteriologiskt och
histologiskt verifierad
Tuberculosis organorum
respirationis, per bacteriologiam
et histologiam confirmata
A15.0
Lungtuberkulos, verifierad med
mikroskopisk sputumundersökning,
med eller utan odling
A15.1
Lungtuberkulos, verifierad endast
med odling
A15.2
Lungtuberkulos, verifierad
histologiskt
A15.3
Lungtuberkulos, verifierad med icke
angiven metod
A15.4
Tuberkulos i intratorakala
lymfkörtlar, verifierad
bakteriologiskt och histologiskt
Neonatal diarré
Tuberkulos i lymfkörtlar i hilus
Tuberkulos i lymfkörtlar i mediastinum
Tuberkulos i trakeobronkiella
lymfkörtlar
Utesluter:
Primär tuberkulos (A15.7)
A15.5
Tuberkulos i larynx, trakea och
bronker, verifierad bakteriologiskt
och histologiskt
A15.6
Tuberkulös pleurit, verifierad
bakteriologiskt och histologiskt
Pleuratuberkulos
Tuberkulöst empyem
Utesluter:
Tuberkulös pleurit vid verifierad primär
tuberkulos (A15.7)
27
A15.7
Primär tuberkulos i andningsorganen,
verifierad bakteriologiskt och
histologiskt
A15.8
Annan tuberkulos i andningsorganen,
verifierad bakteriologiskt och
histologiskt
A16.5
Pleuratuberkulos UNS
Tuberkulöst empyem UNS
Tuberkulös pleurit UNS
Utesluter:
Primär tuberkulos i andningsorganen
(A16.7)
Tuberkulos i nasofarynx
Tuberkulos i näsa och sinus
A15.9
A16
Tuberkulos i andningsorganen,
ospecificerad, verifierad
bakteriologiskt och histologiskt
A16.7
Tuberkulos i andningsorganen,
ej verifierad bakteriologiskt
eller histologiskt
Lungtuberkulos med bakteriologiskt
och histologiskt negativt fynd
A16.1
Lungtuberkulos, bakteriologisk och
histologisk undersökning ej
genomförd
A16.2
Lungtuberkulos, utan uppgift om
bakteriologisk eller histologisk
verifikation
A16.8
A16.9
Tuberkulos i ospecificerat
andningsorgan utan uppgift om
bakteriologisk eller histologisk
verifikation
Tuberkulos i andningsorgan UNS
Tuberkulos UNS
A17†
Tuberkulos i intratorakala
lymfkörtlar, utan uppgift om
bakteriologisk eller histologisk
verifikation
Tuberkulos i nervsystemet
Tuberculosis systematis nervosi
Tuberkulos i intratorakala lymfkörtlar
UNS
Tuberkulos i lymfkörtlar i hilus UNS
Tuberkulos i mediastinala lymfkörtlar
UNS
Tuberkulos i trakeobronkiella
lymfkörtlar UNS
Utesluter:
Primärtuberkulos (A16.7)
A16.4
Annan tuberkulos i andningsorganen
utan uppgift om bakteriologisk eller
histologisk verifikation
Mediastinal tuberkulos UNS
Tuberkulos i:
• nasofarynx UNS
• näsa UNS
• sinus UNS
Lungtuberkulos UNS
A16.3
Primär tuberkulos i andningsorganen
utan uppgift om bakteriologisk eller
histologisk verifikation
Primär tuberkulos i andningsorganen
UNS
Tuberkulöst primärkomplex
Tuberculosis organorum
respirationis, per bacteriologiam
sive histologiam non confirmata
A16.0
Tuberkulös pleurit utan uppgift om
bakteriologisk eller histologisk
verifikation
A17.0†
Tuberkulös meningit (G01*)
A17.1†
Meningealt tuberkulom (G07*)
A17.8†
Annan tuberkulos i nervsystemet
A17.9†
Tuberkulos i nervsystemet,
ospecificerad (G99.8*)
Tuberkulos i larynx, trakea och bronk
utan uppgift om bakteriologisk eller
histologisk verifikation
28
Tuberkulos i cerebrala och spinala
hjärnhinnor
Tuberkulös leptomeningit
Tuberkulom i hjärnhinna
Tuberkulos och tuberkulom i hjärna
och ryggmärg (G07*)
Tuberkulös:
• hjärnabscess (G07*)
• meningoencefalit (G05.0*)
• myelit (G05.0*)
• polyneuropati (G63.0*)
A18
A18.4
Tuberkulos i andra organ
Tuberculosis aliorum organorum
A18.0†
A18.1†
A18.2
Lupus excedens
Lupus vulgaris i ögonlock† (H03.1*)
Lupus vulgaris UNS
Scrofuloderma
Tuberkulöst erythema induratum
Tuberkulos i skelettet och lederna
Tuberkulos i:
• höft (M01.1*)
• knä (M01.1*)
• kotpelare (M49.0*)
Tuberkulös:
• artrit (M01.1*)
• bennekros (M90.0*)
• mastoidit (H75.0*)
• osteit (M90.0*)
• osteomyelit (M90.0*)
• synovit (M68.0*)
• tenosynovit (M68.0*)
Utesluter:
Lupus erythematosus (L93.-)
Systemisk lupus (M32.-)
Tuberkulos i urin- och könsorganen
Tuberkulos i:
• cervix (N74.0*)
• manliga könsorganen (N51.-*)
• njure (N29.1*)
• uretär (N29.1*)
• urinblåsan (N33.0*)
Tuberkulös inflammation i bäckenet hos
kvinna (N74.1*)
Tuberkulös perifer lymfadenopati
Tuberkulös adenit
Utesluter:
Tuberkulos i lymfkörtlar:
• intratorakala (A15.4, A16.3)
• mesenteriala och retroperitoneala
(A18.3)
Tuberkulös trakeobronkial adenopati
(A15.4, A16.3)
A18.3
Tuberkulos i hud och subkutan
vävnad
A18.4C
Lupus vulgaris UNS
A18.4D
Scrofuloderma
A18.4E
Tuberkulöst erythema induratum
A18.4F
Tuberkulöst erythema nodosum
A18.4G
Tuberkulöst hudsår
A18.4H
Tuberculosis verrucosa cutis
A18.4J
Acne scrofulosorum
A18.4K
Lichen scrofulosorum
A18.4L
Papulonekrotisk tuberkulid
A18.4X
Tuberkulos i hud och subkutan vävnad,
ospecificerad
A18.5†
Tuberkulos i öga
Tuberkulos i tarmarna, peritoneum
och mesenterialkörtlarna
Tuberkulos i:
• anus och rektum† (K93.0*)
• retroperitoneala lymfkörtlarna
• tunntarmen och tjocktarmen†
(K93.0*)
Tuberkulös:
• ascites
• enterit† (K93.0*)
• peritonit† (K67.3*)
Tuberkulös:
• episklerit (H19.0*)
• interstitiell keratit (H19.2*)
• keratokonjunktivit, flyktenulär form
(H19.2*)
• korioretinit (H32.0*)
• kronisk iridocyklit (H22.0*)
Utesluter:
Lupus vulgaris i ögonlock (A18.4)
A18.6†
Tuberkulos i öra
Tuberkulös otitis media (H67.0*)
Utesluter:
Tuberkulös mastoidit (A18.0†)
A18.7†
29
Tuberkulos i binjurar (E35.1*)
Tuberkulös Addisons sjukdom
A18.8†
VISSA DJURBURNA
BAKTERIESJUKDOMAR (A20-A28)
Tuberkulos i andra specificerade
organ
Tuberkulos i:
• endokardiet (I39.8*)
• esofagus (K23.0*)
• myokardiet (I41.0*)
• perikardiet (I32.0*)
• tyreoidea (E35.0*)
Tuberkulös cerebral arterit (I68.1*)
A19
Morbi bacteriales zoonotici
A20
Pest
Pestis
Innefattar:
Infektion orsakad av Yersinia pestis
Miliartuberkulos (utspridd
tuberkulos)
A20.0
Böldpest
Tuberculosis miliaris
A20.1
Cellulokutan pest
A20.2
Lungpest
A20.3
Meningit av Yersinia pestis
A20.7
Pestseptikemi
A20.8
Andra specificerade pestformer
A20.9
Pest, ospecificerad
A21
Tularemi (harpest)
Innefattar:
Disseminerad tuberkulos
Generaliserad tuberkulos
Tuberkulös polyserosit
A19.0
Akut miliartuberkulos, en enda
specificerad lokalisation
A19.1
Akut miliartuberkulos, flera
lokalisationer
A19.2
Ospecificerad akut miliartuberkulos
A19.8
Annan miliartuberkulos
A19.9
Miliartuberkulos, ospecificerad
Abortiv pest
Asymtomatisk pest
Pestis minor
Tularaemia
Innefattar:
Hjortflugefeber
Infektion med Francisella tularensis
Kanin- eller harpest
30
A21.0
Ulceroglandulär tularemi
A21.1
Okuloglandulär tularemi
A21.2
Pulmonell tularemi
A21.3
Gastrointestinal tularemi
A21.7
Generaliserad tularemi
A21.8
Andra specificerade tularemiformer
A21.9
Tularemi, ospecificerad
Abdominell tularemi
A22
Mjältbrand
A24.2
Subakut och kronisk melioidos
Anthrax
A24.3
Annan specificerad melioidos
Innefattar:
Infektion orsakad av Bacillus anthracis
A24.4
Melioidos, ospecificerad
A25
Råttbettsfeber
A22.0
Kutan antrax
A22.1
Pulmonell antrax
Infektion orsakad av Burkholderia
(Pseudomonas) pseudomallei
Malign karbunkel och pustel
Febris morsus muris
Inhalationsantrax
Ragpickers disease
Woolsorters disease
A22.2
Gastrointestinal antrax
A22.7
Antraxsepsis
A22.8
Andra specificerade antraxformer
A22.9
Antrax, ospecificerad
A23
Undulantfeber
Antraxmeningit† (G01*)
A25.0
Spirillos
A25.1
Streptobacillos
A25.9
Råttbettsfeber, ospecificerad
A26
Erysipeloid
Sodoku
Haverhill-feber
Streptobacillär råttbettsfeber
Erysipeloides
Brucellosis
A26.0
Kutan erysipeloid
Innefattar:
Maltafeber
Medelhavsfeber
A26.7
Sepsis orsakad av Erysipelothrix
A26.8
Andra specificerade former av
erysipeloid
A26.9
Erysipeloid, ospecificerad
A27
Leptospiros
A23.0
Brucellos orsakad av Brucella
melitensis
A23.1
Brucellos orsakad av Brucella abortus
A23.2
Brucellos orsakad av Brucella suis
A23.3
Brucellos orsakad av Brucella canis
A23.8
Annan specificerad brucellos
A23.9
Brucellos, ospecificerad
A24
Rots och melioidos
Leptospirosis
Malleus et melioidosis
A24.0
Rots
A24.1
Akut och fulminant melioidos
Infektion orsakad av Burkholderia
(Pseudomonas) mallei
Malleus
Melioidospneumoni
Melioidossepsis
31
A27.0
Leptospirosis icterohaemorrhagica
A27.8
Andra specificerade former av
leptospiros
A27.9
Leptospiros, ospecificerad
Leptospiros orsakad av Leptospira
interrogans serovar icterohaemorrhagiae
A28
Andra djurburna
bakteriesjukdomar som ej
klassificeras på annan plats
ANDRA BAKTERIESJUKDOMAR
(A30-A49)
Alii morbi bacteriales
Alii morbi bacteriales zoonotici,
non alibi classificati
A28.0
Pasteurellos
A28.1
Cat-scratch-feber
A28.2
Extraintestinal yersinios
A30
Innefattar:
Infektion orsakad av Mycobacterium
leprae
Utesluter:
Sena följdtillstånd efter lepra (B92)
Septikemi orsakad av Yersinia
enterocolitica
Utesluter:
Enterit orsakad av Yersinia enterocolitica
(A04.6)
Pest (A20.-)
A28.8
A28.9
Lepra
Lepra
Andra specificerade djurburna
bakteriesjukdomar som ej
klassificeras på annan plats
Djurburen bakteriesjukdom,
ospecificerad
A30.0
Obestämbar lepra (dåligt avgränsad)
A30.1
Tuberkuloid lepra
A30.2
Borderline-tuberkuloid lepra
A30.3
Borderline-lepra
A30.4
Borderline-lepromatös lepra
A30.5
Lepromatös lepra
A30.8
Andra specificerade former av lepra
A30.9
Lepra, ospecificerad
A31
Sjukdomar orsakade av andra
mykobakterier
Alii morbi mycobacterici
I-lepra
TT-lepra
BT-lepra
BB-lepra
BL-lepra
LL-lepra
Utesluter:
Lepra (A30.-)
Tuberkulos (A15-A19)
A31.0
Mykobakteriell lungaffektion
A31.1
Mykobakteriell hudaffektion
A31.8
Andra specificerade mykobakteriella
infektioner
A31.9
Mykobakteriell infektion,
ospecificerad
Infektion orsakad av Mycobacterium
avium, intracellulare (Battey-bacillen)
och kansasii
Infektion orsakad av Mycobacterium
marinum och Mycobacterium ulcerans
Atypisk mykobakteriell infektion UNS
Mykobakterios UNS
32
A32
Listerios
A36.3
Listeriosis
Innefattar:
Födoämnesburen listeriainfektion
Hudlisterios
A32.1†
Meningit och meningoencefalit
orsakad av Listeria
Meningit orsakad av Listeria (G01*)
Meningoencefalit orsakad av Listeria
(G05.0*)
A32.7
Sepsis orsakad av Listeria
A32.8
Andra former av listerios
Listerios, ospecificerad
A33
Stelkramp hos nyfödd
Tetanus neonatorum
A34
A36.8
Andra former av difteri
A36.9
Difteri, ospecificerad
A37
Kikhosta
A37.0
Kikhosta orsakad av Bordetella
pertussis
A37.1
Kikhosta orsakad av Bordetella
parapertussis
A37.8
Kikhosta orsakad av andra
specificerade bordetellaarter
A37.9
Kikhosta, ospecificerad
A38
Scharlakansfeber
Scarlatina
Obstetrisk stelkramp
Utesluter:
Streptokockangina (enbart) (J02.0)
Tetanus obstetricus
A35
Annan stelkramp
A39
Alius tetanus
Meningokockinfektion
Infectio meningococcica
Tetanus UNS
Utesluter:
Tetanus neonatorum (A33)
Obstetrisk tetanus (A34)
A36
Difterisk myokardit† (I41.0*)
Difterisk polyneuropati† (G63.0*)
Konjunktivit orsakad av difteri†
(H13.1*)
Pertussis
Cerebral arterit orsakad av Listeria†
(I68.1*)
Endokardit orsakad av Listeria† (I39.8*)
Okuloglandulär listerios
A32.9
Kutan difteri
Sårdifteri
Utesluter:
Erythrasma (L08.1)
Utesluter:
Disseminerad listerios hos nyfödd
(P37.2)
A32.0
Difteri i hud
A39.0†
Meningokockmeningit (G01*)
A39.1†
Waterhouse-Friderichsens syndrom
(E35.1*)
Adrenalt meningokocksyndrom
Hemorragisk inflammation i binjurar
orsakad av meningokocker
Difteri
Diphtheria
A36.0
Svalgdifteri
A39.2
Akut meningokockemi
A36.1
Difteri i nasofarynx
A39.3
Kronisk meningokockemi
A36.2
Larynxdifteri
Angina med difteriska membraner
Tonsilldifteri
Septiskt syndrom orsakad av
meningokocker
Meningokockemi utan septiskt syndrom
Utesluter:
Bärare av meningokocker (Z22.3)
Difterisk laryngotrakeit
33
A39.4
Meningokockemi, ospecificerad
A39.5†
Hjärtsjukdom orsakad av
meningokocker
A41
Annan sepsis
Alia sepsis
Tilläggskod (R57.2) kan användas för att
ange septisk chock
Meningokockendokardit (I39.8*)
Meningokockkardit UNS (I52.0*)
Meningokockmyokardit (I41.0*)
Meningokockperikardit (I32.0*)
A39.8
Andra meningokockinfektioner
A39.9
Meningokockinfektion, ospecificerad
A40
Sepsis orsakad av
streptokocker
Utesluter:
Bakteriemi UNS (A49.9)
Sepsis:
• efter abort, extrauteringraviditet eller
mola (O03-O07, O08.0)
• efter infusion, transfusion eller
injektion i behandlingssyfte (T80.2)
• efter kirurgiskt ingrepp (T81.4)
• efter vaccination (T88.0)
• under barnsängstiden (O85)
• under nyföddhetsperioden (P36.-)
• under värkarbete (O75.3)
Sepsis orsakad av/vid:
• aktinomykos (A42.7)
• antrax (A22.7)
• candida (B37.7)
• erysipeloid (A26.7)
• extraintestinal yersinios (A28.2)
• gonokocker (A54.8)
• listeria (A32.7)
• melioidos (A24.1)
• meningokocker (A39.2-A39.4)
• pest (A20.7)
• streptokocker (A40.-)
• tularemi (A21.7)
Toxic shock syndrome (A48.3)
Artrit efter meningokockinfektion†
(M03.0*)
Meningokockartrit† (M01.0*)
Meningokockencefalit† (G05.0*)
Meningokockkonjunktivit† (H13.1*)
Retrobulbärneurit orsakad av
meningokocker† (H48.1*)
Sjukdom orsakad av meningokocker
UNS
Sepsis streptococcica
Tilläggskod (R57.2) kan användas för att
ange septisk chock
Utesluter:
Neonatal septikemi (P36.0-P36.1)
Sepsis:
• efter abort, extrauteringraviditet eller
mola (O03-O07, O08.0)
• efter infusion, transfusion och
injektion i behandlingssyfte (T80.2)
• efter operativt ingrepp (T81.4)
• efter vaccination (T88.0)
• hos nyfödd (P36.0-P36.1)
• under barnsängstiden (O85)
• under värkarbete (O75.3)
A41.0
Sepsis orsakad av Staphylococcus
aureus
A41.1
Sepsis orsakad av annan specificerad
stafylokock
Koagulasnegativ stafylokock
A41.2
Sepsis orsakad av ospecificerad
stafylokock
A40.0
Sepsis orsakad av streptokocker
grupp A
A41.3
Sepsis orsakad av Haemophilus
influenzae
A40.1
Sepsis orsakad av streptokocker
grupp B
A41.4
Sepsis orsakad av anaeroba bakterier
A40.2
A40.3
Utesluter:
Gasgangrän (A48.0)
Sepsis orsakad av streptokocker
grupp D
A41.5
Sepsis orsakad av Streptococcus
pneumoniae
Gramnegativ sepsis UNS
Pneumokocksepsis
A40.8
Annan streptokocksepsis
A40.9
Streptokocksepsis, ospecificerad
Sepsis orsakad av andra
gramnegativa organismer
34
A41.8
Andra specificerade former av sepsis
A41.9
Sepsis, ospecificerad
Septikemi
A42
Aktinomykos (strålsvamp)
A48
Actinomycosis
Andra bakteriesjukdomar som
ej klassificeras på annan plats
Utesluter:
Aktinomycetom (B47.1)
Alii morbi bacteriales, non alibi
classificati
A42.0
Pulmonell aktinomykos
Utesluter:
Aktinomycetom (B47.1)
A42.1
Abdominell aktinomykos
A42.2
Cervikofacial aktinomykos
A42.7
A48.0
Gasgangrän
Aktinomykotisk sepsis
A48.1
Legionärsjuka
A42.8
Andra specificerade former av
aktinomykos
A48.2
A42.9
Aktinomykos, ospecificerad
Icke-pneumonisk legionärsjuka
[Pontiac-feber]
A43
Nokardios
Pulmonell nokardios
A43.1
Kutan nokardios
A43.8
Andra specificerade former av
nokardios
A43.9
Nokardios, ospecificerad
A44
Bartonellos
Legionella pneumoni
Icke-pneumonisk legionellos
A48.3
Toxic shock syndrome [TSS]
Utesluter:
Endotoxinchock UNS (R57.8)
Sepsis UNS (A41.9)
Nocardiosis
A43.0
Klostridiecellulit
Klostridiemyonekros
A48.4
Brasiliansk purpurafeber
A48.8
Andra specificerade
bakteriesjukdomar
A49
Bakterieinfektion med
ospecificerad lokalisation
Bartonellosis
Systemisk Haemophilus aegyptiusinfektion
Infectio bacterialis, loco non
indicato
A44.0
Systemisk bartonellos
A44.1
Kutan och mukokutan bartonellos
A44.8
Andra specificerade former av
bartonellos
A44.9
Bartonellos, ospecificerad
A49.0
Stafylokockinfektion, ospecificerad
lokalisation
A46
Rosfeber
A49.1
Streptokock- och
enterokockinfektion, ospecificerad
lokalisation
A49.2
Haemophilus influenzae-infektion,
ospecificerad lokalisation
Utesluter:
Bakterier som orsak till sjukdomar som
klassificeras under andra kapitel (B95B96)
Klamydiainfektion UNS (A74.9)
Meningokockinfektion UNS (A39.9)
Rickettsiasjukdom UNS (A79.9)
Spiroketinfektion UNS (A69.9)
Oroyafeber
Verruga peruana
Erysipelas
Utesluter:
Erysipelas efter förlossning eller under
barnsängstiden (O86.8)
35
A49.3
Mykoplasmainfektion, ospecificerad
lokalisation
HUVUDSAKLIGEN SEXUELLT
ÖVERFÖRDA INFEKTIONER (A50-A64)
Utesluter:
Mykoplasmabronkit (J20.0)
Mykoplasmapneumoni (J15.7)
Infectiones, praecipue sexualiter
transmissae
A49.8
Infektion med andra bakterier,
ospecificerad lokalisation
A49.9
Bakterieinfektion, ospecificerad
Utesluter:
Icke specifik och icke gonorroisk uretrit (N34.1)
Reiters sjukdom (M02.3)
Sjukdom orsakad av humant immunbristvirus [HIV]
(B20-B24)
Bakteriemi UNS
A50
Medfödd syfilis
Syphilis congenita
A50.0
Tidig medfödd syfilis med symtom
A50.1
Tidig medfödd latent syfilis
A50.2
Ospecificerad tidig medfödd syfilis
A50.3
Sen medfödd syfilitisk okulopati
Varje medfött syfilitiskt tillstånd som
specificeras som tidigt eller som
uppträder inom två år efter födelsen
Medfödd syfilis utan kliniska
manifestationer med positiv serologisk
reaktion och negativt lumbalvätskeprov
och som uppträder inom två år efter
födelsen
Medfödd syfilis UNS som uppträder
inom två år efter födelsen
Sen medfödd syfilitisk interstitiell
keratit† (H19.2*)
Sen medfödd syfilitisk okulopati som ej
klassificeras på annan plats (H58.8*)
Utesluter:
Hutchinsons triad (A50.5)
A50.4
Sen medfödd neurosyfilis [juvenil
neurosyfilis]
Dementia paralytica juvenilis
Juvenil paralysie générale
Juvenil tabes dorsalis
Juvenil taboparetisk neurosyfilis
Sen medfödd syfilitisk encefalit†
(G05.0*)
Sen medfödd syfilitisk meningit† (G01*)
Sen medfödd syfilitisk polyneuropati†
(G63.0*)
Tilläggskod kan användas för att ange med
tillståndet samtidigt förekommande
psykisk sjukdom
Utesluter:
Hutchinsons triad (A50.5)
36
A50.5
Annan sen medfödd syfilis med
symtom
Varje medfött syfilitiskt tillstånd, som
specificeras som sent eller som uppträder
två år eller senare efter födseln
Cluttons leder† (M03.1*)
Hutchinsons tänder
Hutchinsons triad
Sen medfödd kardiovaskulär syfilis†
(I98.0*)
Sen medfödd syfilitisk artropati†
(M03.1*)
Sen medfödd syfilitisk osteokondropati†
(M90.2*)
Syfilitisk sadelnäsa
A50.6
A50.7
A51.4
Annan sekundär syfilis
A51.5
Tidig latent syfilis
A51.9
Tidig syfilis, ospecificerad
A52
Sen syfilis
Sen medfödd latent syfilis
Medfödd syfilis utan kliniska
manifestationer med positiv serologisk
reaktion och negativt lumbalvätskeprov,
som uppträder två år eller senare efter
födelsen
A50.9
Medfödd syfilis, ospecificerad
A51
Tidig syfilis
A52.0†
Kardiovaskulär syfilis
A52.1
Symtomatisk neurosyfilis
A52.2
Asymtomatisk neurosyfilis
A52.3
Neurosyfilis, ospecificerad
Syphilis recens
A51.0
Primär genital syfilis
A51.1
Primär anal syfilis
A51.2
Primär syfilis med andra
lokalisationer
A51.3
Sekundär syfilis i hud och slemhinnor
A51.3A
Condyloma latum
A51.3B
Syfilitisk (sekundär) alopeci† (L99.8*)
A51.3C
Syfilitisk leukoderma† (L99.8*)
A51.3X
Sekundär syfilis i hud och slemhinnor,
ospecificerad
Syfilitisk schanker UNS
Condyloma latum
Syfilitisk alopeci† (L99.8*)
Syfilitisk leukoderma† (L99.8*)
Syfilitiskt muköst plaque
37
Förvärvad syfilis utan kliniska
manifestationer, med positiv serologisk
reaktion och negativt lumbalvätskeprov
inom två år efter infektionen
Syphilis tarda
Ospecificerad sen medfödd syfilis
Medfödd syfilis UNS som uppträder två
år eller senare efter födelsen
Sekundärsyfilitisk:
• inflammatorisk sjukdom i kvinnliga
bäckenet† (N74.2*)
• iridocyklit† (H22.0*)
• lymfadenopati
• meningit† (G01*)
• myosit† (M63.0*)
• okulopati som ej klassificeras på
annan plats† (H58.8*)
• periostit† (M90.1*)
Kardiovaskulär syfilis UNS (I98.0*)
Syfilitisk:
• aortainsufficiens (I39.1*)
• aortit (I79.1*)
• cerebral arterit (I68.1*)
• endokardit UNS (I39.8*)
• myokardit (I41.0*)
• perikardit (I32.0*)
• pulmonalisinsufficiens (I39.3*)
Syfilitiskt aortaaneurysm (I79.0*)
Charcots ledsjukdom† (M14.6*)
Dementia paralytica† (F02.8*)
Paralysie générale† (F02.8*)
Sensyfilitisk:
• akustikusneurit† (H94.0*)
• encefalit† (G05.0*)
• meningit† (G01*)
• optikusatrofi† (H48.0*)
• polyneuropati† (G63.0*)
• retrobulbärneurit† (H48.1*)
Syfilitisk parkinsonism† (G22*)
Tabes dorsalis
Sen syfilis i centrala nervsystemet UNS
Syfilitisk gumma i centrala nervsystemet
UNS
Syfilom i centrala nervsystemet UNS
A52.7
A52.8
Annan symtomatisk sen syfilis
Glomerulär sjukdom vid syfilis†
(N08.0*)
Ospecificerat stadium av syfilis i:
• benvävnad† (M90.2*)
• lever† (K77.0*)
• lungor† (J99.8*)
• muskler† (M63.0*)
• synovialmembran† (M68.0*)
Sen eller tertiär syfilis och syfilitisk
gumma oavsett lokalisation med
undantag för de som klassificeras under
A52.0-A52.3
Sensyfilitisk:
• bursit† (M73.1*)
• episklerit† (H19.0*)
• inflammationssjukdom i kvinnliga
bäckenet† (N74.2*)
• korioretinit† (H32.0*)
• leukoderma† (L99.8*)
• okulopati som ej klassificeras på
annan plats† (H58.8*)
• peritonit† (K67.2*)
Sen latent syfilis
Syfilis (förvärvad) utan kliniska
manifestationer, med positiv serologisk
reaktion och negativt lumbalvätskeprov,
två år eller mer efter infektion
A52.9
Sen syfilis, ospecificerad
A53
Annan och ospecificerad syfilis
Infectio gonococcica
A54.0
Gonokockinfektion i könsorganen och
de nedre urinvägarna utan abscess i
periuretrala eller accessoriska körtlar
Gonokockcervicit UNS
Gonokockcystit UNS
Gonokockuretrit UNS
Gonokockvulvovaginit UNS
Utesluter:
Infektion förenad med körtelabscess i
urogenitalorganen (A54.1)
eller med periuretral abscess (A54.1)
A54.0A
Gonokockcervicit UNS
A54.0C
Gonokockuretrit UNS
A54.0D
Gonokockvulvovaginit UNS
A54.0E
Gonokockbalanit (akut) (kronisk)
A54.0F
Gonokockorsakad lymfangit i penis
A54.0X
Gonokockinfektion i könsorgan och
nedre urinvägar utan abscess,
ospecificerad
A54.1
Gonokockinfektion i könsorganen och
de nedre urinvägarna med abscess i
periuretrala och accessoriska körtlar
A54.2†
Latent syfilis, ej specificerad som tidig
eller sen
Gonokockpelviperitonit och andra
gonokockinfektioner i urin- och
könsorganen
Av gonokocker orsakad:
• epididymit (N51.1*)
• inflammation i det kvinnliga
bäckenet (N74.3*)
• orkit (N51.1*)
• prostatit (N51.0*)
Latent syfilis UNS
Positiv serologisk reaktion för syfilis
A53.9
Gonokockinfektion
Gonokockabscess i Bartholins körtel
Alia syphilis et syphilis non
specificata
A53.0
A54
Syfilis ospecificerad
Syfilis (förvärvad) UNS
Infektion orsakad av Treponema
pallidum UNS
Utesluter:
Gonokockperitonit (A54.8)
Utesluter:
Syfilis UNS, som orsakar död hos barn
under två års ålder (A50.2)
A54.3
38
Gonokockinfektion i ögat
Gonokockiridocyklit† (H22.0*)
Gonokockkonjunktivit† (H13.1*)
Ophthalmia neonatorum orsakad av
gonokocker
A54.4†
Gonokockinfektion i muskuloskeletala
systemet
Gonokockartrit (M01.3*)
Gonokockbursit (M73.0*)
Gonokockosteomyelit (M90.2*)
Gonokocksynovit (M68.0*)
Gonokocktenosynovit (M68.0*)
A54.5
Gonokockfaryngit
A54.6
Gonokockinfektion i anus och rektum
A54.8
Andra gonokockinfektioner
Av gonokocker orsakad:
• endokardit† (I39.8*)
• hjärnabscess† (G07*)
• hudförändring
• meningit† (G01*)
• myokardit† (I41.0*)
• perikardit† (I32.0*)
• peritonit† (K67.1*)
• pneumoni† (J17.0*)
• sepsis
Gonokockinfektion, ospecificerad
A55
Lymfogranulom (veneriskt)
orsakat av klamydia
Klamydiacervicit
Klamydiacystit
Klamydiauretrit
Klamydiavulvovaginit
A56.0A
Klamydiacervicit
A56.0C
Klamydiauretrit
A56.0D
Klamydiavulvovaginit
A56.0X
Klamydiainfektion i nedre delen av urinoch könsorganen, ospecificerad
A56.1†
Klamydiainfektion i pelviperitoneum
och andra urin- och könsorgan
A56.2
Klamydiainfektion i urin- och
könsorganen, ospecificerad
A56.3
Klamydiainfektion i anus och rektum
A56.4
Klamydiainfektion i svalget
A56.8
Sexuellt överförd klamydiainfektion
med andra specificerade
lokalisationer
A57
Chankroid (mjuk schanker)
Lymphogranuloma venereum e
Chlamydia
A56
Klamydiainfektion i nedre delen av
urin- och könsorganen
Klamydiaepididymit (N51.1*)
Klamydiainflammation i kvinnliga
bäckenet (N74.4*)
Klamydiaorkit (N51.1*)
Utesluter:
Gonokockpelviperitonit (A54.2)
A54.9
A56.0
Andra sexuellt överförda
klamydiasjukdomar
Chancroides
Alii morbi e Chlamydia, sexualiter
transmissi
Innefattar:
Sexuellt överförda sjukdomar orsakade
av Chlamydia trachomatis
Ulcus molle
A58
Granuloma inguinale
Granuloma inguinale
Donovanos
Utesluter:
Klamydialymfogranulom (A55)
Konjunktivit hos nyfödd orsakad av
klamydia (P39.1)
Pneumoni hos nyfödd orsakad av
klamydia (P23.1)
Sjukdomstillstånd orsakade av klamydia
som klassificeras under A74.-
39
A59
Trikomonasinfektion
Trichomoniasis
Utesluter:
Trikomonasinfektion i tarm (A07.8)
A59.0
Urogenital trikomonasinfektion
Leukorré (vaginal) orsakad av
Trichomonas (vaginalis)
Prostatit orsakad av Trichomonas
(vaginalis)† (N51.0*)
A59.8
Trikomonasinfektion med andra
lokalisationer
ANDRA SPIROKETSJUKDOMAR
(A65-A69)
A59.9
Trikomonasinfektion, ospecificerad
Alii morbi spirochaetales
A60
Utesluter:
Leptospiros (A27.-)
Syfilis (A50-A53)
Anogenital infektion med
herpes simplex-virus
Infectio herpetica analis et
genitalis
A60.0
A65
Syphilis non venerea
Bejel
Urogenital infektion med herpes
simplex-virus
Herpes simplex-infektion i könsorganen:
• hos kvinna† (N77.0-N77.1*)
• hos man† (N51.-*)
A60.1
Infektion med herpes simplex-virus i
den perianala huden och rektum
A60.9
Anogenital infektion med herpes
simplex-virus
A63
A66
Yaws
Yaws
Innefattar:
Buba
Frambösi
Pian
A66.0
Primärlesioner vid yaws
Andra huvudsakligen sexuellt
överförda sjukdomar som ej
klassificeras på annan plats
A66.1
Multipla papillom och wet crab yaws
A66.2
Andra tidiga hudlesioner vid yaws
Alii morbi praecipue sexualiter
transmissi non alibi classificati
A66.3
Hyperkeratos vid yaws
A66.4
Gumma och sår vid yaws
A66.5
Gangosa
A66.6
Ben- och ledlesioner vid yaws
A66.7
Andra manifestationer vid yaws
A66.8
Latent yaws
A66.9
Yaws, ospecificerad
A67
Pinta
Pinta
Utesluter:
Molluscum contagiosum (B08.1)
Papillom i cervix (D26.0)
A63.0
Condyloma acuminatum
A63.0A
Spetsiga kondylom
A63.0B
Platta kondylom
A63.0X
Kondylom, ospecificerade
A63.8
Andra specificerade huvudsakligen
sexuellt överförda sjukdomar
A64
Icke venerisk syfilis
Ospecificerad sexuellt överförd
sjukdom
Morbus sexualiter translatus, non
specificatus
Venerisk sjukdom UNS
Sexually transmitted disease [STD] UNS
Sexuellt överförd sjukdom UNS
40
Innefattar:
Carate
A67.0
Primära lesioner vid pinta
A67.1
Intermediära lesioner vid pinta
A67.2
Sena lesioner vid pinta
A67.3
Blandade lesioner vid pinta
A67.9
Pinta, ospecificerad
A68
Återfallsfeber
ANDRA SJUKDOMAR ORSAKADE AV
KLAMYDIA (A70-A74)
Febris recurrens
Utesluter:
Infektion orsakad av Borrelia burgdorferi
(A69.2)
A68.0
A68.1
Återfallsfeber orsakad av Borrelia
recurrentis
Ornitos
Psittakos
Återfallsfeber orsakad av varje annan
borreliaart än Borrelia recurrentis
A69
Andra spiroketinfektioner
A71
Utesluter:
Sena effekter av trakom (B94.0)
Nekrotiserande ulcerös stomatit
Cancrum oris
Fusospiroketalt gangrän
Gangränös stomatit
Noma
Andra Vincent-infektioner
Akut ulcererande gingivostomatit
Vincents angina
Vincents angina
A69.1B
Ulcererande gingivostomatit (akut)
A69.1W
Annan Vincent-infektion
A69.2
Infektion orsakad av Borrelia
burgdorferi
Andra specificerade
spiroketinfektioner
A69.9
Spiroketinfektion, ospecificerad
A71.0
Trakom i tidigt stadium
A71.1
Trakom i aktivt skede
A71.9
Trakom, ospecificerad
A74
Andra sjukdomar orsakade av
klamydier
Trachoma dubium
Follikulär trakomatös konjunktivit
Granulär trakomatös konjunktivit
Trakomatös pannus
Alii morbi e Chlamydia
Artrit orsakad av borrelia† (M01.2*)
Borreliainfektion UNS
Borrelios UNS
Erythema (chronicum) migrans
Myokardit orsakad av borrelia† (I41.2*)
Neuroborrelios† (G01*)
A69.8
Trakom
Trachoma
Aliae infectiones spirochaetales
A69.1A
Infektion orsakad av Chlamydia
psittaci (papegojsjuka)
Infectio e Chlamydia psittaci
Återfallsfeber överförd av fästingar
Återfallsfeber, ospecificerad
A69.1
A70
Återfallsfeber överförd av löss
A68.9
A69.0
Alii morbi e Chlamydia
Utesluter:
Klamydiapneumoni (J16.0)
Klamydiakonjunktivit hos nyfödd
(P39.1)
Klamydiapneumoni hos nyfödd (P23.1)
Sexuellt överförda klamydiasjukdomar
(A55-A56)
A74.0†
Klamydiakonjunktivit (H13.1*)
A74.8
Andra specificerade
klamydiainfektioner
Paratrakom
Klamydiaperitonit† (K67.0*)
A74.9
41
Klamydiainfektion, ospecificerad
A77.2
SJUKDOMAR ORSAKADE AV
RICKETTSIAARTER (A75-A79)
Nordasiatisk fästingfeber
Sibirisk fästingfeber
Rickettsioses
A75
A77.3
Fläcktyfus överförd av löss,
loppor och kvalster
Utesluter:
Rickettsios orsakad av Neorickettsia
sennetsu [Ehrlichia sennetsu] (A79.8)
Epidemisk fläcktyfus orsakad av
Rickettsia prowazekii
Fläcktyfus med återuppblossande
[Brills sjukdom]
A78
Q-feber
Infektion orsakad av Coxiella burnetii
A79
Andra rickettsiasjukdomar
A79.0
Skyttegravsfeber
A79.1
Rickettsia-koppor orsakade av
Rickettsia akari
Quintan-feber
Wolhynien-feber
Kew Garden fever
Vesikulär rickettsios
A79.8
A75.9
Fläcktyfus, ospecificerad
A77
Rickettsiasjukdom överförd av
fästingar
Andra specificerade
rickettsiasjukdomar
Rickettsios orsakad av Neorickettsia
sennetsu [Ehrlichia sennetsu] (A79.8)
Fläcktyfus UNS
Rickettsiosis per ixodidam
Fläckfeber orsakad av Rickettsia
rickettsii
Rocky Mountain-fläckfeber
Sao Paulo-feber
A77.1
Fläckfeber, ospecificerad
Fläcktyfus orsakad av Rickettsia
tsutsugamushi
Fläcktyfus överförd av kvalster
Tsutsugamushi-feber
A77.0
A77.9
Fläcktyfus orsakad av Rickettsia
typhi
Murin (loppburen) fläcktyfus
A75.3
Annan specificerad fläckfeber
Aliae rickettsioses
Brill-Zinssers sjukdom
A75.2
A77.8
Febris Q
Epidemisk fläcktyfus (överförd av löss)
Klassisk fläcktyfus
A75.1
Fläckfeber orsakad av Rickettsia
australis
Queenslandfästingfeber
Typhus exanthematicus per
pediculum, pulicem et acarum
A75.0
Fläckfeber orsakad av Rickettsia
sibirica
Fläckfeber orsakad av Rickettsia
conorii
Afrikansk fästingfeber
Boutonneusfeber
Indisk fästingfeber
Kenyansk fästingfeber
Marseillesfeber
Medelhavsfästingfeber
42
A79.9
Rickettsiasjukdom, ospecificerad
Rickettsiainfektion UNS
VIRUSSJUKDOMAR I CENTRALA
NERVSYSTEMET (A80-A89)
A81.9
Prionsjukdom i centrala nervsystemet
UNS
Viroses systematis nervosi centralis
Utesluter:
Sena effekter av polio (B91)
Sena effekter av virusencefalit (B94.1)
A80
Atypisk virusinfektion i centrala
nervsystemet, ospecificerad
A82
Rabies (vattuskräck)
Rabies
Akut polio (barnförlamning)
Poliomyelitis acuta
A82.0
Rabies, sylvatisk form
Vilddjursrabies
A80.0
Akut polio med förlamningar orsakad
av poliovaccinvirus
A82.1
Rabies, urban form
A80.1
Akut polio med förlamningar orsakad
av vilt importerat virus
A82.9
Rabies, ospecificerad
A80.2
Akut polio med förlamningar orsakad
av vilt inhemskt virus
A83
Virusencefalit överförd av
myggor
A80.3
Akut polio med förlamningar, annan
och ospecificerad
A80.4
Akut polio utan förlamningar
A80.9
Akut polio, ospecificerad
A81
Atypisk virusinfektion i
centrala nervsystemet
Innefattar:
Prionsjukdom i centrala nervsystemet
A81.1
Subakut spongioform encefalopati
Subakut skleroserande panencefalit
[SSPE]
Progressiv multifokal
leukoencefalopati
Multifokal leukoencefalopati UNS
A81.8
Innefattar:
Virusmeningoencefalit överförd av
myggor
A83.0
Japansk encefalit
A83.1
Western equine encephalitis
A83.2
Eastern equine encephalitis
A83.3
St Louis encephalitis
A83.4
Australian encephalitis
A83.5
California encephalitis
A83.6
Rocio-virusencefalit
A83.8
Annan specificerad virusencefalit
överförd av myggor
A83.9
Virusencefalit överförd av myggor,
ospecificerad
Creutzfeldt-Jakobs sjukdom
Dawsons inclusion body-encefalit
van Bogaerts skleroserande
leukoencefalopati
A81.2
Encephalitis viralis per mosquitos
Utesluter:
Venezuelan equine encephalitis (A92.2)
Infectio viralis atypica systematis
nervosi centralis
A81.0
Husdjursrabies
Andra atypiska virusinfektioner i
centrala nervsystemet
Kuru
43
Kunjin encephalitis
La Crosse encephalitis
A84
A84.0
Virusencefalit överförd av
fästingar
A85.1†
Adenoviral encefalit (G05.1*)
Encephalitis viralis per ixodidam
A85.2
Innefattar:
Virusmeningoencefalit överförd av
fästingar
Virusencefalit överförd av leddjur,
ospecificerad
A85.8
Andra specificerade virusencefaliter
A86
Ospecificerad virusencefalit
Fjärranösternencefalit överförd av
fästingar
Russian spring-summer encephalitis
[RSSE]
A84.1
Virusencefalomyelit UNS
Virusmeningoencefalit UNS
Annan specificerad virusencefalit
överförd av fästingar
A87
Louping ill
A84.9
Virusencefalit överförd av fästingar,
ospecificerad
A85
Andra virusencefaliter som ej
klassificeras på annan plats
Virusmeningit
Meningitis viralis
Utesluter:
Meningit orsakad av:
• herpes simplex-virus (B00.3)
• mässlingvirus (B05.1)
• poliovirus (A80.-)
• påssjukevirus (B26.1)
Meningit vid bältros (B02.1)
Aliae encephalitides virales non
alibi classificatae
A87.0†
Innefattar:
Specificerad virusencefalomyelit som ej
klassificeras på annan plats
Specificerad virusmeningoencefalit som
ej klassificeras på annan plats
Utesluter:
Benign myalgisk encefalomyelit (G93.3)
Encefalit orsakad av:
• cytomegalvirus (B25.8)
• herpes simplex-virus (B00.4)
• influensavirus (J10.8, J11.8)
• mässlingvirus (B05.0)
• poliovirus (A80.-)
• påssjukevirus (B26.2)
• rubellavirus (B06.0)
Encefalit vid:
• bältros (B02.0)
• vattkoppor (B01.1)
Lymfocytär koriomeningit (A87.2)
A85.0†
Encephalitis lethargica
von Economo-Cruchets sjukdom
Encephalitis viralis non
specificata
Centraleuropeisk encefalit överförd
av fästingar
Tick-borne encephalitis [TBE]
A84.8
Adenoviral encefalomeningit
Enteroviral encefalit (G05.1*)
Enteroviral encefalomyelit
44
Meningit orsakad av enterovirus
(G02.0*)
Meningit orsakad av coxsackievirus
Meningit orsakad av ECHO-virus
A87.0A† Meningit av Coxsackievirus
A87.0B† Meningit av ECHO-virus
A87.0W† Meningit orsakad av annat specificerat
enterovirus
A87.1†
Meningit orsakad av adenovirus
(G02.0*)
A87.2
Lymfocytär koriomeningit
A87.8
Andra specificerade virusmeningiter
A87.9
Virusmeningit, ospecificerad
Lymfocytär meningoencefalit
Virusmeningit UNS
A88
FEBERSJUKDOMAR ORSAKADE AV
VIRUS ÖVERFÖRDA AV LEDDJUR OCH
VIRUSORSAKADE HEMORRAGISKA
FEBRAR (A92-A99)
Andra virusinfektioner i
centrala nervsystemet som ej
klassificeras på annan plats
Febres virales per arthropoda
transmissae et febres virosae
haemorrhagicae per arthropoda
transmissae
Aliae infectiones virales
systematis nervosi centralis non
alibi classificatae
Utesluter:
Virusencefalit UNS (A86)
Virusmeningit UNS (A87.9)
A88.0
A92
Enteroviral exanthematous fever
[Boston exanthem]
Aliae febres virales per mosquitos
transmissae
Anmärkning:
Denna kod i ICD-10 kan ifrågasättas och
torde ej komma till användning i
Sverige.
A88.1
Epidemisk vertigo
A88.8
Andra specificerade virusinfektioner i
centrala nervsystemet
A89
Ospecificerad virusinfektion i
centrala nervsystemet
Infectio virosa systematis nervosi
centralis non specificata
Andra febersjukdomar än
dengue orsakade av virus
överförda av myggor
Utesluter:
Ross River disease (B33.1)
A92.0
Chikungunya-virussjukdom
A92.1
O'nyong-nyong-feber
A92.2
Venezuelan equine encephalitis
A92.3
West Nile virus-infektion
A92.4
Rift Valley fever
A92.8
Andra specificerade febersjukdomar
orsakade av virus överförda av
myggor
Chikungunya-feber (hemorragisk)
West Nile fever
Ockelbosjuka
A92.9
Febersjukdom orsakad av virus
överförd av myggor, ospecificerad
A93
Andra febersjukdomar
orsakade av virus överförda av
leddjur, som ej klassificeras på
annan plats
Aliae febres virales per
arthropoda transmissae, non alibi
classificatae
45
A93.0
Oropouche-virussjukdom
A93.1
Sandmyggefeber
Oropouche-feber
Pappataci-feber
Phlebotomus-feber
A93.2
Colorado-fästingfeber
A93.8
Andra specificerade
virusfebersjukdomar överförda av
leddjur
A97
Febris dengue
Denguefeber
Anmärkning:
För klassificering av svårighetsgrad och
beskrivning av varningstecken se t.ex.
Handbook för clinical management of
dengue. Word Health Organization 2012
(http://apps.who.int/iris/bitstream/10665/
76887/1/9789241504713_eng.pdf?ua=1)
Allvarlig febersjukdom med
trombocytopenisyndrom
Piryvirusfeber
Vesicular stomatitis virus disease
[Indiana fever]
A94
Ospecificerad febersjukdom
orsakad av virus överfört av
leddjur
A97.0
Febris viralis per arthropoda
transmissa non specificata
A97.1
Arbovirusinfektion UNS
A95
Gula febern
A97.2
Febris flava
A95.0
Gula febern, sylvatisk form
Jungle yellow fever
A95.1
Gula febern, urban form
A95.9
Gula febern, ospecificerad
A96
Arenaviral hemorragisk feber
Dengue
Dengue utan varningstecken
Hemorragisk denguefeber grad 1 och 2
Hemorragisk denguefeber utan
varningstecken
Dengue med varingstecken
Hemorragisk denguefeber med
varningstecken
Allvarlig dengue
Allvarlig denguefeber
Allvarlig hemorragisk denguefeber
A97.9
Dengue, ospecificerad
A98
Andra hemorragiska
febersjukdomar orsakade av
virus som ej klassificeras på
annan plats
Denguefeber UNS
Aliae febres virales
haemorrhagicae non alibi
classificatae
Febris haemorrhagica
arenaviralis
A96.0
Hemorragisk Junin-virusfeber
Argentinsk hemorragisk feber
A98.0
Centralasiatisk hemorragisk feber
A96.1
Machupo hemorragisk feber
A98.1
Omskfeber
A96.2
Lassafeber
A98.2
Kyasanur Forest disease
A96.8
Andra specificerade arenavirala
hemorragiska febrar
A98.3
Marburgfeber
A98.4
Ebolafeber
A96.9
Arenaviral hemorragisk feber,
ospecificerad
Boliviansk hemorragisk feber
46
A98.5
A99
Hemorragisk feber med
njurpåverkan
Hemorragisk feber:
• epidemisk
• koreansk
• rysk
Hantavirusinfektion
Nephropathia epidemica (sorkfeber)†
(N08.0*)
Febris virosa haemorrhagica non
specificata
Utesluter:
Hantavirus med (kardio)pulmonellt syndrom
[HPS] [HCPS] (J17.1* B33.4†)
A98.8
Ospecificerad hemorragisk
febersjukdom orsakad av virus
Andra specificerade virala
hemorragiska febersjukdomar
47
VIRUSSJUKDOMAR MED HUDUTSLAG
OCH SLEMHINNEUTSLAG (B00-B09)
B00.5†
Dermatit i ögonlocken orsakad av herpes
simplex-virus (H03.1*)
Främre uveit orsakad av herpes simplexvirus (H22.0*)
Iridocyklit orsakad av herpes simplexvirus (H22.0*)
Irit orsakad av herpes simplex-virus
(H22.0*)
Keratit orsakad av herpes simplex-virus
(H19.1*)
Keratokonjunktivit orsakad av herpes
simplex-virus (H19.1*)
Konjunktivit orsakad av herpes simplexvirus (H13.1*)
Viroses cum exanthemate et affectiones
mucosae
B00
Herpes simplex-infektioner
Infectiones herpesvirales
Utesluter:
Anogenital infektion med herpes
simplex-virus (A60.-)
Herpangina (B08.5)
Medfödd herpes simplex-infektion
(P35.2)
Mononukleos orsakad av Epstein-Barrvirus (B27.0)
B00.0
Eczema herpeticum
B00.1
Vesikulär dermatit orsakad av herpes
simplex-virus
Kaposis varicelliforma utslag
B00.7
Disseminerad herpes simplexinfektion
B00.8
Andra specificerade former av
infektion med herpes simplex-virus
Hepatit orsakad av herpes simplex-virus†
(K77.0*)
Paronyki orsakad av herpes simplexvirus† (L99.8*)
Herpes labialis
B00.1A
Herpes labialis
B00.1B
Herpes facialis
B00.1W
Vesikulär dermatit orsakad av herpes
simplex-virus, annan lokalisation
Ögonsjukdom orsakad av herpes
simplex-virus
B00.9
Herpes simplex-infektion,
ospecificerad
Infektion med herpes simplex UNS
B01
B00.1X
Vesikulär dermatit orsakad av herpes
simplex-virus, ospecificerad lokalisation
B00.2
Gingivostomatit och faryngotonsillit
orsakade av herpes simplex-virus
Herpes simplex-faryngit
B00.3†
Meningit orsakad av herpes simplexvirus (G02.0*)
B00.4†
Encefalit orsakad av herpes simplexvirus (G05.1*)
Meningoencefalit orsakad av herpes
simplex-virus
Simian B disease
Vattkoppor
Varicellae
B01.0†
Vattkoppor med meningit (G02.0*)
B01.1†
Vattkoppsencefalit (G05.1*)
B01.2†
Vattkoppor med pneumoni (J17.1*)
B01.8
Vattkoppor med andra specificerade
komplikationer
B01.9
Vattkoppor utan komplikation
B02
Bältros
Vattkoppor med encefalomyelit
Encefalit efter vattkoppor
Varicellae UNS
Herpes zoster
48
B02.0†
Bältros med encefalit (G05.1*)
B02.1†
Bältros med meningit (G02.0*)
Meningoencefalit vid zoster
B02.2†
Bältros med andra komplikationer
från nervsystemet
Postherpetisk:
• genikulatumganglionit (G53.0*)
• polyneuropati (G63.0*)
• trigeminusneuralgi (G53.0*)
B02.3†
Bältros med ögonkomplikationer
Bältros med:
• blefarit (H03.1*)
• iridocyklit (H22.0*)
• irit (H22.0*)
• keratit (H19.2*)
• keratokonjunktivit (H19.2*)
• konjunktivit (H13.1*)
• sklerit (H19.0*)
B02.7
Generaliserad bältros
B02.8
Bältros med andra specificerade
komplikationer
B02.9
Bältros utan komplikation
B03
Pneumoni som komplikation till
mässling (J17.1*)
B05.3†
Otit som komplikation till mässling
(H67.1*)
B05.4
Mässling med tarmkomplikationer
B05.8
Mässling med andra specificerade
komplikationer
Keratit och keratokonjunktivit i samband
med mässling† (H19.2*)
B05.9
Mässling utan komplikation
B06
Röda hund
Rubella
B06.0†
Herpes zoster UNS
Zoster UNS
Smittkoppor
B06.8
Apkoppor
B06.9
Röda hund utan komplikation
B07
Virusvårtor
Rubella UNS
Verrucae virogenes
Verruca simplex
Verruca vulgaris
Mässling
Utesluter:
Blåspapillom (D41.4)
Cervixpapillom (D26.0)
Condyloma acuminatum (A63.0)
Larynxpapillom (D14.1)
Morbilli
Utesluter:
Subakut skleroserande panencefalit
(A81.1)
B05.1†
Röda hund med andra specificerade
komplikationer
Rubellaartrit† (M01.4*)
Rubellapneumoni† (J17.1*)
Variola simialis
B05.0†
Röda hund med neurologiska
komplikationer
Rubellaencefalit (G05.1*)
Rubellameningit (G02.0*)
Rubellameningoencefalit (G05.1*)
Anmärkning:
År 1980 förklarade den trettiotredje
World Health Assembly att smittkoppor
utrotats. Klassifikationen behålls för
översiktens skull
B05
Mässling UNS
Utesluter:
Medfödd rubella (P35.0)
Variola
B04
B05.2†
Mässlingsencefalit (G05.1*)
Encefalit efter mässling
Encefalit i samband med mässling
Mässlingsmeningit (G02.0*)
Meningit efter mässling
Meningit i samband med mässling
49
B07.9A
Verruca vulgaris
B07.9B
Verruca filiformis
B07.9C
Verruca plana
B07.9D
Verruca plantaris
B07.9W
Andra virusvårtor
B07.9X
Virusvårtor, ospecificerade
B08
Andra virussjukdomar med
hud- och slemhinneutslag som
ej klassificeras på annan plats
Alii morbi virales cum laesionibus
cutaneis et mucocutaneis non
alibi classificati
B08.0
VIRUSHEPATIT (B15-B19)
Hepatitis viralis
Utesluter:
Hepatit orsakad av cytomegalvirus (B25.1)
Hepatit orsakad av herpes simplex-virus (B00.8)
Sena effekter av virushepatit (B94.2)
Utesluter:
Vesicular stomatitis virus disease
[Indiana fever] (A93.8)
B15
Andra infektioner orsakade av
ortopoxvirus
B15.0
Hepatit A med leverkoma
B15.9
Hepatit A utan leverkoma
B16
Akut hepatit B
Hepatitis acuta A
Echtyma contagiosum
Orf
Smittsam pustulös dermatit
Utesluter:
Apkoppor (B04)
B08.0A
Ecthyma contagiosum
B08.0B
Falska kokoppor
B08.0C
Kokoppor
B08.0W
Akut hepatit A
Akut virushepatit A UNS
Hepatit A UNS
Hepatitis acuta B
B16.0
Akut hepatit B med hepatit D
(coinfection) med leverkoma
Annan och ospecificerad infektion
orsakad av ortopoxvirus
B16.1
Akut hepatit B med hepatit D
(coinfection) utan leverkoma
B08.1
Mollusker
B16.2
Akut hepatit B utan hepatit D med
leverkoma
B08.2
Tredagarsfeber
B16.9
Akut hepatit B utan hepatit D, och
utan leverkoma
Molluscum contagiosum
Exanthema subitum
Sjätte sjukan
B08.3
Erythema infectiosum
B08.4
Hand, foot and mouth disease
B08.5
Herpangina
Akut (virus)hepatit B UNS
Hepatit B UNS
Femte sjukan
B17
Vesikulär stomatit med exantem orsakad
av enterovirus
Vesikulär faryngit orsakad av enterovirus
B08.8
Andra specificerade virusinfektioner
med hud- och slemhinneutslag
B09
Ospecificerad virusinfektion
med hud- och slemhinneutslag
Infectio viralis non specificata
cum laesionibus cutaneis et
mucocutaneis
Virusenantem UNS
Virusexantem UNS
50
Annan akut virushepatit
Alia hepatitis viralis acuta
B17.0
Akut hepatit D (superinfektion) hos
hepatit B-bärare
B17.1
Akut hepatit C
B17.2
Akut hepatit E
B17.8
Annan specificerad akut virushepatit
B17.9
Akut virushepatit, ospecificerad
Akut virushepatit non-A non-B som ej
klassificeras på annan plats
Hepatit non-A non-B som ej klassificeras
på annan plats
Akut hepatit UNS
Akut infektiös hepatit
B18.1E
Kronisk hepatit B utan hepatit D,
kronisk aktiv hepatit med cirros
B18.1F
Kronisk hepatit B utan hepatit D, fibros
B18.1G
Kronisk hepatit B utan hepatit D, cirros
B18.1H
Kronisk hepatit B utan hepatit D, steatos
B18.1W
Kronisk hepatit B utan hepatit D, annat
histologiskt fynd
B18.1X
Kronisk hepatit B utan hepatit D, ej
biopserad
B18.2
Kronisk (virus)hepatit C
B18.2A
Kronisk hepatit C, normal lever
B18.2B
Kronisk hepatit B med hepatit D
(coinfection), kronisk aktiv hepatit med
cirros
Kronisk hepatit C, ospecifik reaktiv
hepatit
B18.2C
Kronisk hepatit C, kronisk persisterande
hepatit (KPH)
B18.0F
Kronisk hepatit B med hepatit D
(coinfection), fibros
B18.2D
Kronisk hepatit C, kronisk aktiv hepatit
(KAH)
B18.0G
Kronisk hepatit B med hepatit D
(coinfection), cirros
B18.2E
Kronisk hepatit C, kronisk aktiv hepatit
med cirros
B18.0H
Kronisk hepatit B med hepatit D
(coinfection), steatos
B18.2F
Kronisk hepatit C, fibros
B18.0W
Kronisk hepatit B med hepatit D
(coinfection), annat histologiskt fynd
B18.2G
Kronisk hepatit C, cirros
B18.2H
Kronisk hepatit C, steatos
B18.0X
Kronisk hepatit B med hepatit D
(coinfection), ej biopserad
B18.2W
Kronisk hepatit C, annat histologiskt
fynd
B18.1
Kronisk (virus)hepatit B utan
hepatit D
B18.2X
Kronisk hepatit C, ej biopserad
B18.8
Kronisk hepatit B utan hepatit D, normal
lever
Annan specificerad kronisk
virushepatit
B18.8A
Kronisk hepatit B utan hepatit D,
ospecifik reaktiv hepatit
Annan specificerad kronisk virushepatit,
normal lever
B18.8B
Kronisk hepatit B utan hepatit D,
kronisk persisterande hepatit (KPH)
Annan specificerad kronisk virushepatit,
ospecifik reaktiv hepatit
B18.8C
Kronisk hepatit B utan hepatit D,
kronisk aktiv hepatit (KAH)
Annan specificerad kronisk virushepatit,
kronisk persisterande hepatit (KPH)
B18.8D
Annan specificerad kronisk virushepatit,
kronisk aktiv hepatit (KAH)
B18
Kronisk virushepatit
Hepatitis viralis chronica
B18.0
Kronisk (virus)hepatit B med hepatit
D (coinfection)
B18.0A
Kronisk hepatit B med hepatit D
(coinfection), normal lever
B18.0B
Kronisk hepatit B med hepatit D
(coinfection), ospecifik reaktiv hepatit
B18.0C
Kronisk hepatit B med hepatit D
(coinfection), kronisk persisterande
hepatit (KPH)
B18.0D
B18.0E
Kronisk hepatit B med hepatit D
(coinfection), kronisk aktiv hepatit
(KAH)
(Virus)hepatit B
B18.1A
B18.1B
B18.1C
B18.1D
51
Annan specificerad kronisk virushepatit,
kronisk aktiv hepatit med cirros
B19
B18.8F
Annan specificerad kronisk virushepatit,
fibros
B19.0
Ospecificerad virushepatit med
leverkoma
B18.8G
Annan specificerad kronisk virushepatit,
cirros
B19.9
Ospecificerad virushepatit utan
leverkoma
B18.8H
Annan specificerad kronisk virushepatit,
steatos
B18.8W
Annan specificerad kronisk virushepatit,
annat
B18.8X
Annan specificerad kronisk virushepatit,
ej biopserad
B18.9
Kronisk virushepatit, ospecificerad
B18.9A
Kronisk virushepatit, ospecificerad,
normal lever
B18.9B
Kronisk virushepatit, ospecificerad,
ospecifik reaktiv hepatit
B18.9C
Kronisk virushepatit, ospecificerad,
kronisk persisterande hepatit (KPH)
B18.9D
Kronisk virushepatit, ospecificerad,
kronisk aktiv hepatit (KAH)
B18.9E
Kronisk virushepatit, ospecificerad,
kronisk aktiv hepatit med cirros
B18.9F
Kronisk virushepatit, ospecificerad,
fibros
B18.9G
Kronisk virushepatit, ospecificerad,
cirros
B18.9H
Kronisk virushepatit, ospecificerad,
steatos
B18.9W
Kronisk virushepatit, ospecificerad,
annat histologiskt fynd
B18.9X
Kronisk virushepatit, ospecificerad, ej
biopserad
B18.8E
52
Ospecificerad virushepatit
Hepatitis viralis non specificata
Virushepatit UNS
SJUKDOM ORSAKAD AV HUMANT
IMMUNBRISTVIRUS [HIV] (B20-B24)
B21
Morbus e viro humano
immunodeficientiam provocanti [HIV]
Anmärkning:
Vid sjukhusbruk och annan morbiditetsstatistik bör
man registrera de specifika tillstånd som ingår i B20B23 separat
Utesluter:
Asymtomatisk HIV-infektion (Z21)
Positiv HIV-serologi utan säker HIV-infektion (R75)
Som komplikation till graviditet, förlossning och
barnsängstid (O98.7)
B20
Sjukdom orsakad av humant
immunbristvirus [HIV]
tillsammans med infektionsoch parasitsjukdom
Morbus e viro HIV, cum morbo
infectioso sive parasitario
Utesluter:
Akut HIV-infektionssyndrom (B23.0)
B20.0
HIV-infektion med
mykobakterieinfektion
HIV-infektion med tuberkulos
B20.1
HIV-infektion med andra
bakterieinfektioner
B20.2
HIV-infektion med
cytomegalvirusinfektion
B20.3
HIV-infektion med andra
virusinfektioner
Sjukdom orsakad av humant
immunbristvirus [HIV]
tillsammans med maligna
tumörer
Morbus e viro HIV cum
neoplasmatibus malignis
B21.0
HIV-infektion med Kaposis sarkom
B21.1
HIV-infektion med Burkitts lymfom
B21.2
HIV-infektion med andra typer av
non-Hodgkin-lymfom
B21.3
HIV-infektion med andra maligna
tumörer i lymfoid, blodbildande och
besläktad vävnad
B21.7
HIV-infektion med multipla maligna
tumörer
B21.8
HIV-infektion med andra
specificerade maligna tumörer
B21.9
HIV-infektion med ospecificerad
malign tumör
B22
Sjukdom orsakad av humant
immunbristvirus [HIV]
tillsammans med andra
specificerade sjukdomar
Morbus e viro HIV cum aliis
morbis specificatis
B22.0
HIV-infektion med encefalopati
B22.1
HIV-infektion med lymfoid
interstitiell pneumonit
HIV-demens
B20.4
HIV-infektion med candidainfektion
B20.5
HIV-infektion med andra mykoser
B20.6
HIV-infektion med Pneumocystis
jirovecii (carinii)-pneumoni
B22.2
HIV-infektion med extrem avmagring
B20.7
HIV-infektion med multipla
infektioner
B22.7
B20.8
HIV-infektion med andra infektionsoch parasitsjukdomar
HIV-infektion med multipla
sjukdomar som klassificeras på annan
plats
B20.9
HIV-infektion med ospecificerad
infektions- eller parasitsjukdom
HIV-infektion med infektion UNS
53
HIV-infektion med failure to thrive
Slim disease
Anmärkning:
För användning av denna kategori
hänvisas till kodinstruktioner för
morbiditet och mortalitet
B23
Sjukdom orsakad av humant
immunbristvirus [HIV]
tillsammans med andra
tillstånd
ANDRA VIRUSSJUKDOMAR (B25-B34)
Aliae viroses
B25
Morbus e viro HIV cum aliis
conditionibus
Cytomegalvirussjukdom
Morbus cytomegaloviralis
Utesluter:
Medfödd cytomegalvirusinfektion
(P35.1)
Mononukleos orsakad av cytomegalvirus
(B27.1)
B23.0
Akut HIV-infektionssyndrom
B23.1
HIV-infektion med (kvarstående)
generaliserad lymfadenopati
B23.2
HIV-infektion med hematologiska och
immunologiska avvikelser som ej
klassificeras på annan plats
B25.0†
Cytomegalviruspneumonit (J17.1*)
B25.1†
Cytomegalvirushepatit (K77.0*)
HIV-infektion med andra
specificerade sjukdomstillstånd
B25.2†
Cytomegalviruspankreatit (K87.1*)
B25.8
Ospecificerad sjukdom
orsakad av humant
immunbristvirus [HIV]
Andra specificerade
cytomegalvirusinfektioner
B25.9
Cytomegalvirussjukdom,
ospecificerad
Morbus e viro HIV non
specificatus
B26
Påssjuka
B23.8
B24
Acquired immunodeficiency syndrome
[AIDS] UNS
AIDS-related complex [ARC] UNS
Parotitis epidemica
Innefattar:
Epidemisk parotit
Infektiös parotit
B26.0†
Påssjukeorkit (N51.1*)
B26.1†
Påssjukemeningit (G02.0*)
B26.2†
Påssjukeencefalit (G05.1*)
B26.3†
Påssjukepankreatit (K87.1*)
B26.8
Påssjuka med andra specificerade
komplikationer
Påssjukeartrit† (M01.5*)
Påssjukemyokardit† (I41.1*)
Påssjukenefrit† (N08.0*)
Påssjukepolyneuropati† (G63.0*)
B26.9
54
Påssjuka utan komplikation
Påssjuka UNS
B27
Körtelfeber
B33.1
Ross River disease
B33.2
Viruskardit
B33.3
Retrovirusinfektion som ej
klassificeras på annan plats
Mononucleosis infectiosa
B27.0
Mononukleos orsakad av EpsteinBarr-virus
B27.1
Mononukleos orsakad av
cytomegalvirus
Retrovirusinfektion UNS
B27.8
Annan infektiös mononukleos
B27.9
Infektiös mononukleos, ospecificerad
B30
Viruskonjunktivit
B33.4†
Utesluter:
Hemorragisk feber med
njurmanifestationer (N08.0*A98.5†)
Utesluter:
Ögonsjukdom vid:
• herpes simplex-infektion (B00.5)
• zoster (B02.3)
Keratokonjunktivit orsakad av
adenovirus (H19.2*)
B33.8
Andra specificerade virussjukdomar
B34
Virussjukdom med
ospecificerad lokalisation
Morbus viralis loco non
specificato
Epidemisk keratokonjunktivit
B30.1†
Konjunktivit orsakad av adenovirus
(H13.1*)
Utesluter:
Cytomegalvirussjukdom UNS (B25.9)
Herpes simplex-infektion UNS (B00.9)
Retrovirusinfektion UNS (B33.3)
Virus som orsak till sjukdomar som
klassificeras i andra kapitel (B97.-)
Akut follikulär konjunktivit orsakad av
adenovirus
Simbassäng-konjunktivit
B30.2
Faryngokonjunktivit orsakad av virus
B30.3†
Akut epidemisk hemorragisk
konjunktivit (orsakad av enterovirus)
(H13.1*)
Hemorragisk konjunktivit (akut)
(epidemisk)
Konjunktivit orsakad av coxsackievirus
24
Konjunktivit orsakad av enterovirus 70
B30.8†
Annan viruskonjunktivit (H13.1*)
B30.9
Viruskonjunktivit, ospecificerad
B33
Andra virussjukdomar som ej
klassificeras på annan plats
B34.0
Adenovirusinfektion, ospecificerad
lokalisation
B34.1
Enterovirusinfektion, ospecificerad
lokalisation
Coxsackievirusinfektion UNS
ECHO-virusinfektion UNS
B34.1A
Enterovirusinfektion, coxsackie,
ospecificrad lokalisation
B34.1B
Enterovirusinfektion, ECHO,
ospecificerad lokalisation
B34.1W
Annan specificerad enterovirusinfektion,
ospecificerad lokalisation
B34.2
Coronavirusinfektion, ospecificerad
lokalisation
Newcastlekonjunktivit
Alii morbi virales non alibi
classificati
B33.0
Hantavirus med (kardio)pulmonellt
syndrom [HPS] [HCPS] (J17.1*)
Hantavirusinfektion med
lungmanifestationer
Pulmonellt syndrom orsakat av Sin
Nombre-virus
Conjunctivitis viralis
B30.0†
Epidemisk polyartrit och exantem
Ross River fever
Utesluter:
SARS (J12.8 som primärkod och U04.9
som tilläggskod)
Epidemisk myalgi
Bornholmssjuka
55
Parvovirusinfektion, ospecificerad
lokalisation
SVAMPSJUKDOMAR (B35-B49)
B34.4
Papovavirusinfektion, ospecificerad
lokalisation
B34.8
Infektion med andra virus,
ospecificerad lokalisation
Utesluter:
Pneumonit orsakad av överkänslighet för organiskt
damm (J67.-)
Mycosis fungoides (C84.0)
B34.9
Virusinfektion, ospecificerad
B34.3
Mycoses
B35
Viremi UNS
Virusinfektion UNS
Dermatofytos
(hudsvampsjukdom)
Dermatophytosis
Innefattar:
Favus
Infektion med arter av Epidermophyton,
Microsporum, och Trichophyton
Tinea, alla former utom de som
klassificeras under B36.-
B35.0
Dermatofytos i hårbotten och
skäggbotten
Kerion Celsi
Ringorm i hårbotten
Skäggsvamp
Sycosis mycotica
Tinea barbae
Tinea capitis
Tinea faciei
56
B35.0A
Kerion Celsi
B35.0B
Ringorm i hårbotten
B35.0C
Skäggsvamp
B35.0D
Sycosis mycotica
B35.0E
Tinea faciei
B35.0X
Dermatofytos i hårbotten och
skäggbotten, ospecificerad
B35.1
Nagelsvamp
B35.1A
Tinea unguium
B35.1B
Leukonychia trichophytica
B35.1X
Nagelsvamp, ospecificerad
B35.2
Dermatofytos på hand
Dermatofytisk onyki
Onykomykos
Tinea unguium
Handringorm
Tinea manuum
B35.3
B35.4
B35.5
B35.6
B35.8
B37
Dermatofytos på fot
Fotsvamp
Tinea pedis
Candidainfektion
Candidiasis
Innefattar:
Infektion med candidaarter
Dermatofytos på bålen
Ringorm på bålen
Tinea corporis
Utesluter:
Candidainfektion hos nyfödd (P37.5)
Tinea imbricata
Tokelau
Dermatofytos på benet
Ringorm i ljumske
Tinea cruris
Tinea inguinalis
B37.0
Candidainfektion i munnen
B37.1
Candidainfektion i lunga
B37.2
Candidainfektion i hud och naglar
Andra dermatofytoser
Disseminerad dermatofytos
Granulomatös dermatofytos
Muntorsk
Candidaonyki
Candidaparonyki
Utesluter:
Blöjdermatit (L22)
B35.8A
Disseminerad dermatofytos
B37.2A
Candidaonyki
B35.8B
Granulomatös dermatofytos
B37.2B
Candidaparonyki
B35.8W
Andra specificerade dermatofytoser
B37.2C
Candidaintertrigo
B35.9
Dermatofytos, ospecificerad
B37.2D
Interdigital candidainfektion
B37.2X
Candidainfektion i hud och naglar,
ospecificerad
B37.3†
Candidainfektion i vulva och vagina
(N77.1*)
B36
Favus UNS
Ringorm UNS
Andra ytliga mykoser
Aliae mycoses superficiales
B36.0
B36.1
Candidavulvovaginit
Vaginal torsk
Pityriasis versicolor
Tinea flava
Tinea versicolor
B37.4†
Tinea nigra
Candidabalanit (N51.2*)
Candidauretrit (N37.0*)
Keratomycosis nigricans palmaris
Microsporosis nigra
Pityriasis nigra
B36.2
Vit piedra
B36.3
Svart piedra
B36.8
Andra specificerade ytliga mykoser
B36.9
Ytlig mykos, ospecificerad
Candidainfektion i andra
urogenitalorgan
Tinea blanca
B37.5†
Candidameningit (G02.1*)
B37.6†
Candidaendokardit (I39.8*)
B37.7
Candidasepsis
B37.8
Candidainfektion med andra
lokalisationer
Candidakeilit
Candidaenterit
Disseminerad candidainfektion
Kronisk mukokutan candidiasis
Perlèche orsakad av candidainfektion
Otomykos UNS (H62.2*)
B37.8A
57
Candidakeilit
B37.8B
Candidaenterit
B37.8C
Disseminerad candidainfektion
B37.8D
Candidaesofagit
B37.8W
Candidainfektion med andra
lokalisationer
B37.9
B38
B39.4
Amerikansk histoplasmos
B39.5
Torsk UNS
B39.9
Histoplasmos, ospecificerad
B40
Blastomykos
Blastomycosis
Koccidioidomykos
Utesluter:
Sydamerikansk blastomykos (B41.-)
Lobomykos (B48.0)
Coccidioidomycosis
B38.0
Akut pulmonell koccidioidomykos
B38.1
Kronisk pulmonell koccidioidomykos
B38.2
Pulmonell koccidioidomykos,
ospecificerad
Kutan koccidioidomykos
B38.4†
Koccidioidomykosmeningit (G02.1*)
B38.7
Disseminerad koccidioidomykos
B38.8
Andra specificerade former av
koccidioidomykos
B38.9
Koccidioidomykos, ospecificerad
B39
Histoplasmos
Generaliserad koccidioidomykos
Histoplasmosis
Akut pulmonell histoplasmos orsakad
av Histoplasma capsulatum
B39.1
Kronisk pulmonell histoplasmos
orsakad av Histoplasma capsulatum
B39.3
B40.0
Akut pulmonell blastomykos
B40.1
Kronisk pulmonell blastomykos
B40.2
Pulmonell blastomykos, ospecificerad
B40.3
Kutan blastomykos
B40.7
Disseminerad blastomykos
B40.8
Andra specificerade former av
blastomykos
B40.9
Blastomykos, ospecificerad
B41
Parakoccidioidomykos
Blastomykotisk dermatit
Generaliserad blastomykos
Paracoccidioidomycosis
B39.0
B39.2
Histoplasmos orsakad av Histoplasma
duboisii
Afrikansk histoplasmos
Candidainfektion, ospecificerad
B38.3
Histoplasmos orsakad av Histoplasma
capsulatum, ospecificerad
Innefattar:
Lutz sjukdom
Parakoccidios
Sydamerikansk blastomykos
B41.0
Pulmonell parakoccidioidomykos
Ospecificerad pulmonell histoplasmos
orsakad av Histoplasma capsulatum
B41.7
Disseminerad parakoccidioidomykos
Disseminerad histoplasmos orsakad
av Histoplasma capsulatum
B41.8
Andra specificerade former av
parakoccidioidomykos
B41.9
Parakoccidioidomykos, ospecificerad
Generaliserad histoplasmos orsakad av
Histoplasma capsulatum
58
Generaliserad parakoccidioidomykos
B42
Sporotrikos
B45
Sporotrichosis
Kryptokockos
Cryptococcosis
B42.0†
Pulmonell sporotrikos (J99.8*)
B45.0
Kryptokockos i lunga
B42.1
Lymfokutan sporotrikos
B45.1
Cerebral kryptokockos
B42.7
Disseminerad sporotrikos
B45.2
Kutan kryptokockos
B42.8
Andra specificerade former av
sporotrikos
B45.3
Kryptokockos i benvävnad
B42.9
Sporotrikos, ospecificerad
B45.7
Disseminerad kryptokockos
B45.8
B43
Kromomykos och feomykotisk
abscess
Andra specificerade former av
kryptokockos
B45.9
Kryptokockos, ospecificerad
Chromomycosis et abscessus
phaeomycoticus
B46
Zygomykos
B43.0
Generaliserad sporotrikos
Zygomycosis
Kutan kromomykos
Dermatitis verrucosa
B43.1
Feomykotisk hjärnabscess
B43.2
Subkutan feomykotisk abscess och
cysta
B43.8
Andra specificerade former av
kromomykos
Cerebral kromomykos
B43.9
Kromomykos, ospecificerad
B44
Aspergillos
Aspergillosis
B44.0
Invasiv lungaspergillos
B44.1
Annan lungaspergillos
Kryptokockmeningit† (G02.1*)
Aspergillom i lunga
Aspergillos i bronk
B46.0
Pulmonell mucormykos
B46.1
Rinocerebral mucormykos
B46.2
Gastrointestinal mucormykos
B46.3
Kutan mucormykos
B46.4
Disseminerad mucormykos
B46.5
Mucormykos, ospecificerad
B46.8
Andra specificerade zygomykoser
B46.9
Zygomykos, ospecificerad
B47
Mycetom
Subkutan mucormykos
Generaliserad mucormykos
Entomophthoromykos
Fykomykos UNS
Mycetoma
B44.2
Tonsillaspergillos
B44.7
Disseminerad aspergillos
B47.0
Eumycetom
B44.8
Andra specificerade former av
aspergillos
B47.1
Aktinomycetom
B44.9
Aspergillos, ospecificerad
B47.9
Mycetom, ospecificerat
Generaliserad aspergillos
59
Mykotisk madurafot
Maduromykos
Madurafot UNS
B48
Andra mykoser som ej
klassificeras på annan plats
PROTOZOSJUKDOMAR (B50-B64)
Morbi protozoici
Aliae mycoses non alibi
classificatae
B48.0
Lobomykos
B48.1
Rinosporidios
B48.2
Allescheriasis
Utesluter:
Amöbiasis (A06.-)
Andra tarmsjukdomar orsakade av protozoer (A07.-)
Trikomonasinfektion (A59.-)
B50
Infektion med Pseudallescheria boydii
Malaria per Plasmodium
falciparum
Utesluter:
Eumycetom (B47.0)
B48.3
Geotrikos
B48.4
Penicillos
B48.7
Opportunistisk mykos
Innefattar:
Blandade infektioner av Plasmodium
falciparum och andra plasmodiumarter
Geotrichum-stomatit
B50.0
Andra specificerade mykoser
B49
Ospecificerad mykos
Malaria orsakad av Plasmodium
falciparum med cerebrala
komplikationer
Cerebral malaria UNS
Infektion i hud, underhud och andra
organ med flera olika svamparter,
vanligen apatogena, men som hos
nedgångna personer eller personer med
nedsatt immunförsvar kan framkalla
sjukdom, t ex infektion med arter som
Alternaria, Dreschlera och Fusarium
B48.8
Malaria orsakad av
Plasmodium falciparum
B50.8
Annan svår eller komplicerad malaria
orsakad av Plasmodium falciparum
Svår eller komplicerad falciparummalaria UNS
B50.9
Malaria orsakad av Plasmodium
falciparum utan komplikationer
Falciparum-malaria UNS
Adiaspiromykos
B51
Mycosis non specificata
Malaria orsakad av
Plasmodium vivax
Malaria per Plasmodium vivax
Innefattar:
Blandad infektion av Plasmodium vivax
och andra plasmodiumarter med
undantag för Plasmodium falciparum
Utesluter:
Om blandad med Plasmodium
falciparum (B50.-)
B51.0
Malaria orsakad av Plasmodium
vivax med mjältruptur
B51.8
Malaria orsakad av Plasmodium
vivax med andra komplikationer
B51.9
Malaria orsakad av Plasmodium
vivax utan komplikationer
Plasmodium vivax-malaria UNS
60
B52
Malaria orsakad av
Plasmodium malariae
B54
Malaria non specificata
Malaria per Plasmodium malariae
Innefattar:
Blandad infektion av Plasmodium
malariae med andra plasmodiumarter
med undantag för Plasmodium
falciparum och Plasmodium vivax
Kliniskt diagnostiserad malaria som ej
verifierats parasitologiskt
B55
Leishmanios
Leishmaniosis
Utesluter:
Om blandad med:
• Plasmodium falciparum (B50.-)
• Plasmodium vivax (B51.-)
B52.0
Malaria, ospecificerad
Malaria orsakad av Plasmodium
malariae med nefropati
B55.0
Visceral leishmanios
B55.1
Kutan leishmanios
B55.2
Mukokutan leishmanios
Kala-azar
Post-kala-azar dermal leishmanios
B52.8
Malaria orsakad av Plasmodium
malariae med andra komplikationer
B55.9
Leishmanios, ospecificerad
B52.9
Malaria orsakad av Plasmodium
malariae utan komplikationer
B56
Afrikansk trypanosomiasis
(sömnsjuka)
Plasmodium malariae-malaria UNS
B53
Trypanosomiasis africana
Annan parasitologiskt
verifierad malaria
Alia malaria, specie parasiti
definita
B53.0
Malaria orsakad av Plasmodium
ovale
Utesluter:
Om blandad med:
• Plasmodium falciparum (B50.-)
• Plasmodium malariae (B52.-)
• Plasmodium vivax (B51.-)
B53.1
Gambiense-trypanosomiasis
B56.1
Rhodesiense-trypanosomiasis
B56.9
Afrikansk trypanosomiasis,
ospecificerad
Infektion orsakad av Trypanosoma
brucei gambiense
Västafrikansk sömnsjuka
Infektion orsakad av Trypanosoma
brucei rhodesiense
Östafrikansk sömnsjuka
Sömnsjuka UNS
Trypanosomiasis UNS på platser där
afrikansk trypanosomiasis förekommer
Malaria orsakad av ap-plasmodier
Utesluter:
Om blandad med:
• Plasmodium falciparum (B50.-)
• Plasmodium malariae (B52.-)
• Plasmodium ovale (B53.0)
• Plasmodium vivax (B51.-)
B53.8
B56.0
B57
Chagas sjukdom
Morbus Chaga
Innefattar:
Amerikansk trypanosomiasis
Infektion orsakad av Trypanosoma cruzi
Annan parasitologiskt verifierad
malaria som ej klassificeras på annan
plats
Parasitologiskt verifierad malaria UNS
61
B57.0†
Akut Chagas sjukdom med
hjärtengagemang
Akut Chagas sjukdom med:
• kardiovaskulärt engagemang som ej
klassificeras på annan plats (I98.1*)
• myokardit (I41.2*)
B57.1
B59
Akut Chagas sjukdom utan
hjärtengagemang
Pneumocystosis
Akut Chagas sjukdom UNS
B57.2†
Pneumocystos
Extrapulmonell Pneumocystis jirovecii
(carinii)-infektion
Pneumoni orsakad av Pneumocystis
jirovecii (carinii)† (J17.3*)
Chagas sjukdom (kronisk) med
hjärtengagemang
Amerikansk trypanosomiasis UNS
Chagas sjukdom (kronisk) med:
• kardiovaskulärt engagemang som ej
klassificeras på annan plats (I98.1*)
• myokardit (I41.2*)
Chagas sjukdom (kronisk) UNS
Trypanosomiasis UNS på platser där
Chagas sjukdom förekommer
B60
Andra protozosjukdomar som
ej klassificeras på annan plats
Alii morbi protozoici non alibi
classificati
Utesluter:
Kryptosporidios (A07.2)
Intestinal mikrosporidios (A07.8)
Isosporiasis (A07.3)
B57.3
Chagas sjukdom (kronisk) med
engagemang av mag-tarmkanalen
B57.4
Chagas sjukdom (kronisk) med
engagemang av nervsystemet
B60.0
Babesios
B57.5
Chagas sjukdom (kronisk) med
engagemang av andra organ
B60.1
Acanthamoebiasis
B60.2
Naegleriasis
B60.8
Andra specificerade
protozosjukdomar
B58
Toxoplasmos
Toxoplasmosis
Innefattar:
Infektion orsakad av Toxoplasma gondii
Utesluter:
Medfödd toxoplasmos (P37.1)
B58.0†
Okulopati vid toxoplasmos
B58.1†
Toxoplasmahepatit (K77.0*)
B58.2†
Meningoencefalit vid toxoplasmos
(G05.2*)
B58.3†
Lungtoxoplasmos (J17.3*)
B58.8
Toxoplasmos med engagemang av
andra organ
Keratokonjunktivit orsakad av
Acanthamoeba† (H19.2*)
Konjunktivit orsakad av Acanthamoeba†
(H13.1*)
Primär meningoencefalit orsakad av
amöba† (G05.2*)
Mikrosporidios
Korioretinit vid toxoplasmos (H32.0*)
B64
Ospecificerad protozosjukdom
Morbi protozoici non specificati
Toxoplasmamyokardit† (I41.2*)
Toxoplasmamyosit† (M63.1*)
B58.9
Piroplasmos
Toxoplasmos, ospecificerad
62
MASKSJUKDOMAR (B65-B83)
B66.3
Fascioliasis
B66.4
Paragonimiasis
Infektion med Schistosoma
haematobium
B66.5
Fasciolopsiasis
B65.1
Infektion med Schistosoma mansoni
B66.8
Andra specificerade
trematodinfektioner
B65.2
Infektion med Schistosoma japonicum
B65.3
Cercariadermatit
B65.8
Andra specificerade former av
schistosomiasis
Helminthiases
B65
Schistosomiasis
Schistosomiasis
Innefattar:
Bilharzios
Snäckfeber
B65.0
Schistosomiasis i urinvägar
Schistosomiasis i tarm
Simmarklåda
B65.9
Schistosomiasis, ospecificerad
B66
Andra trematodinfektioner
(infektioner med flundror och
andra sugmaskar)
B66.1
B66.2
Infektion orsakad av Fasciolopsis buski
Intestinal distomiasis
B66.9
Trematodinfektion, ospecificerad
B67
Blåsmasksjuka
Flundremaskinfektion UNS
Echinococcosis
Innefattar:
Hydatidos
B67.0
Echinococcus granulosus-infektion i
levern
B67.1
Echinococcus granulosus-infektion i
lunga
B67.2
Echinococcus granulosus-infektion i
benvävnad
B67.3
Echinococcus granulosus-infektion
med annan eller multipel lokalisation
B67.4
Ospecificerad Echinococcus
granulosus-infektion
Aliae infestationes trematodicae
B66.0
Infektion med Paragonimus-arter
Lungdistomiasis
Lungmasksjukdom
Echinostomiasis
Heterophyiasis
Metagonimiasis
Nanophyetiasis
Watsoniasis
Asiatisk schistosomiasis
Infektion med:
• Schistosoma intercalatum
• Schistosoma mattheei
• Schistosoma mekongi
Infektion med stora leverflundran
Infektion med:
• Fasciola gigantica
• Fasciola hepatica
• Fasciola indica
Opisthorchiasis
Infektion med Opisthorchis (felineus)
(viverrini)
Clonorchiasis
Infektion med Clonorchis sinensis
Orientalisk levermasksjukdom
Hundbandmaskinfektion
Dicrocoeliasis
Infektion orsakad av Dicrocoelium
dendriticum
Lancet fluke-infektion
63
B67.5
Echinococcus multilocularis-infektion
i levern
B67.6
Echinococcus multilocularis-infektion
med annan eller multipel lokalisation
B67.7
Ospecificerad Echinococcus
multilocularis-infektion
B67.8
Ospecificerad echinokockos i levern
B67.9
Annan och ospecificerad
echinokockos
Echinokockos UNS
B68
Sparganos
B71
Andra bandmaskinfektioner
Taeniainfektion
Utesluter:
Cysticerkos (B69.-)
Infektion med Taenia solium,
intestinal form
B71.0
Hymenolepiasis
B71.1
Dipylidiasis
B71.8
Andra specificerade
bandmaskinfektioner
Svinbandmaskinfektion
B68.1
B68.9
B69
Infektion med diphyllobothrium-larver
Infektion med spirometra-larver
Infektion orsakad av Sparganum
(mansoni) (proliferum)
Alia infestatio cestodica
Taeniasis
B68.0
B70.1
Dvärgbandmaskinfektion
Råttbandmaskinfektion
Coenurosis
Infektion med Taenia saginata
Nötbandmaskinfektion
Taeniainfektion, ospecificerad
Taeniasis UNS
B71.9
Bandmaskinfektion, ospecificerad
B72
Dracontiasis
Bandmaskinfektion UNS
Dracunculiasis
Cysticerkos
Infektion med Guinea-mask
(Dracunculus medinensis)
Cysticercosis
Innefattar:
Cysticerciasis-infektion orsakad av
larvform av Taenia solium
B73
Onchocerciasis
Onchocerciasis
Flodblindhet
Onchocerca volvulus-infektion
Onkocerkos
B69.0
Cysticerkos i centrala nervsystemet
B69.1
Cysticerkos i ögat
B69.8
Cysticerkos med andra lokalisationer
Filariasis
B69.9
Cysticerkos, ospecificerad
B70
Infektion med binnikemaskar
Utesluter:
Onchocerciasis (B73)
Tropisk lungeosinofili UNS (J82)
Neurocysticerkos
B74
Diphyllobothriasis et sparganosis
B70.0
B74.0
Utesluter:
Infektion med larvformen av
diphyllobothriasis
64
Filariainfektion orsakad av
Wuchereria bancrofti
Bancrofti-filariasis
Egentlig filarios
Elefantiasis och lymfangit orsakad av
Wuchereria bancrofti
Diphyllobothriasis
Binnikemask
Diphyllobothrium-infektion
Fiskbandmaskinfektion
Infektion med adult form av
Diphyllobothrium latum eller pacificum
Filariainfektion
B74.1
Filariainfektion orsakad av Brugia
malayi
B74.2
Filariainfektion orsakad av Brugia
timori
B74.3
B78
Loiasis
Afrikansk ögonmasksjukdom
Calabarsvullnad
Infektion orsakad av Loa loa
Strongyloidiasis
B74.4
Infektion med Mansonella ozzardi,
Mansonella perstans eller Mansonella
streptocerca
B74.8
Andra specificerade filariainfektioner
Dirofilarios
B74.9
Filariainfektion, ospecificerad
B75
Trikinos (sjukdom orsakad av
trikiner)
Filarios UNS
Trichinosis
Innefattar:
Infektion med Strongyloides stercoralis
Utesluter:
Trichostrongyliasis (B81.2)
B78.0
Intestinal strongyloidesinfektion
B78.1
Kutan strongyloidesinfektion
B78.7
Disseminerad strongyloidesinfektion
B78.9
Strongyloidesinfektion, ospecificerad
B79
Piskmaskinfektion
Trichuriasis
Infektion med Trichinella-arter
B76
Infektion med Trichuris trichiura
Trichocephaliasis
Hakmasksjukdom
B80
Ancylostomiasis et necatoriasis
Hakmaskinfektion orsakad av
Ancylostoma-arter
B76.1
Hakmaskinfektion orsakad av
Necator americanus
B76.8
Andra specificerade
hakmasksjukdomar
B76.9
Hakmasksjukdom, ospecificerad
B77
Oxyuriasis
B81
Utesluter:
Angiostrongyliasis orsakad av:
• Angiostrongylus cantonensis (B83.2)
• Parastrongylus cantonensis (B83.2)
Kutan larva migrans UNS
B81.0
Anisakiasis
B81.1
Intestinal capillariasis
Spolmaskinfektion
Innefattar:
Infektion med Ascaris lumbricoides
Spolmaskinfektion med andra
komplikationer
B77.9
Spolmaskinfektion, ospecificerad
Infektion med Anisakis-larver
Capillariasis UNS
Infektion med Capillaria philippinensis
Utesluter:
Hepatisk capillariasis (B83.8)
Spolmaskinfektion med
tarmkomplikationer
B77.8
Andra tarmmaskinfektioner
som ej klassificeras på annan
plats
Aliae helminthiases intestinales
non alibi classificatae
Ascaridiasis
B77.0
Springmaskinfektion
Enterobiasis
Innefattar:
Larva migrans orsakad av Anchylostoma
uncinaris
B76.0
Strongyloidesinfektion
Askaridos UNS
65
B81.2
Trichostrongyliasis
B81.3
Intestinal angiostrongyliasis
Angiostrongyliasis orsakad av:
• Angiostrongylus cantonensis (B83.2)
• Parastrongylus cantonensis (B83.2)
B81.4
Blandad tarmmasksjukdom
B83.8
Andra specificerade masksjukdomar
B81.8
Andra specificerade
tarmmasksjukdomar
B83.9
Masksjukdom, ospecificerad
Blandad tarmmasksjukdom UNS
Infektion med tarmmaskar som
klassificeras under mer än en av
kategorierna B65.0-B81.3 och B81.8
Infektion med Oesophagostomum-arter
[oesophagostomiasis]
Infektion med Ternidens deminutus
[ternidensiasis]
B82
Parasitismus intestinalis non
specificatus
Ospecificerad tarmmasksjukdom
B82.9
Sjukdom orsakad av tarmparasit,
ospecificerad
B83
Andra masksjukdomar
Alia helminthiasis
Utesluter:
Capillariasis UNS (B81.1)
Intestinal capillariasis (B81.1)
B83.0
Visceral larva migrans
B83.1
Gnathostomiasis
B83.2
Angiostrongyliasis orsakad av
Angiostrongylus (Parastrongylus)
cantonensis
Toxocariasis
Eosinofil meningoencefalit† (G05.2*)
Utesluter:
Intestinal angiostrongyliasis (B81.3)
B83.3
Syngamiasis
B83.4
Inre hirudiniasis
Mask UNS
Utesluter:
Tarmmasksjukdom UNS (B82.0)
Infektion med ospecificerade
tarmparasiter
B82.0
Acanthocephaliasis
Gongylonemiasis
Hepatisk capillariasis
Metastrongyliasis
Thelaziasis
Syngamosis
Inre blodigelinfestation
Utesluter:
Yttre hirudiniasis (B88.3)
66
LUSANGREPP, ACARINOS (ANGREPP
AV KVALSTER) OCH ANDRA
INFESTATIONER (B85-B89)
B88
Aliae infestationes
B88.0
Pediculosis, acarinosis et aliae
infestationes
B85
Pediculosis et phthiriasis
Huvudlöss
B85.1
Kroppslöss
Klädlöss
Pediculosis corporis
Ospecificerat lusangrepp
B85.3
Flatlöss
B85.4
Blandat lusangrepp
B86
Utesluter:
Scabies (B86)
Pediculosis capitis
B85.2
Pedikulos UNS
Phthiriasis
Angrepp som kan klassificeras under
mer än en av kategorierna B85.0-B85.3
Skabb
Scabies
B87
B88.0A
Dermatit orsakad av Demodex-arter
B88.0B
Dermatit orsakad av Dermanyssus
gallinae
B88.0C
Dermatit orsakad av Liponyssoides
sanguineus
B88.0D
Dermatit orsakad av Cheyletiella-arter
B88.0E
Scabies animalis
B88.0F
Trombiculosis
B88.0W
Annan och ospecificerad akarinos
B88.1
Infestation med sandloppa [Tungiasis]
B88.2
Annan artropodinfestation
B88.3
Yttre hirudiniasis
Infestation av fluglarver
Myiasis
B87.0
Kutan myiasis
B87.1
Myiasis i sår
B87.2
Okulär myiasis
B87.3
Nasofaryngeal myiasis
Traumatisk myiasis
Laryngeal myiasis
Myiasis i öra
B87.8
Myiasis med annan lokalisation
B87.9
Myiasis, ospecificerad
Scarabiasis
Yttre blodigelinfestation
Utesluter:
Inre hirudiniasis (B83.4)
Creeping myiasis
B87.4
Annan akarinos (angrepp av
kvalsterarter)
Dermatit orsakad av:
* Demodex-arter
* Dermanyssus gallinae
* Liponyssoides sanguineus
Kvalsterdermatit
Trombiculosis
Lusangrepp
B85.0
Andra infestationer
B88.8
Andra specificerade infestationer
B88.9
Infestation, ospecificerad
B89
Ospecificerade
parasitsjukdomar
Alii morbi parasitarii non
specificati
Myiasis i ytteröra och hörselgång
Urogenital myiasis
Intestinal myiasis
Ichthyoparasitism orsakad av Vandellia
cirrhosa
Linguatulos
Porocefaliasis
Hudinfestation UNS
Hudparasiter UNS
Infestation med kvalster UNS
Utesluter:
Parasitofobi (F40.2)
67
SENA EFFEKTER AV
INFEKTIONSSJUKDOMAR OCH
PARASITSJUKDOMAR (B90-B94)
B94
Morbi infectiosi et parasitarii, sequelae
Anmärkning:
B90-B94 används för att ange tillstånd under
A00-B89 som orsak till följdtillstånd, vilka själva
klassificeras på annan plats. ”Sena effekter” är följdtillstånd till sjukdomar som klassificeras under de
nämnda kategorierna, om den bakomliggande
sjukdomen inte längre är aktiv.
B90-B94 skall inte användas för kroniska infektioner.
Pågående infektioner kodas som kroniska eller aktiva
infektionssjukdomar.
B90
Sena effekter av tuberkulos
Tuberculosis, sequelae
B90.0
Sena effekter av tuberkulos i centrala
nervsystemet
B90.1
Sena effekter av tuberkulos i urinoch könsorganen
B90.2
Sena effekter av tuberkulos i skelett
och leder
B90.8
Sena effekter av tuberkulos i andra
organ
B90.9
Sena effekter av tuberkulos i
andningsorganen och ospecificerad
tuberkulos
Sena effekter av tuberkulos UNS
B91
Sena effekter av polio
Poliomyelitis, sequelae
Utesluter:
Postpoliosyndrom (G14)
B92
Sena effekter av lepra
Lepra, sequelae
68
Sena effekter av andra och
ospecificerade
infektionssjukdomar och
parasitsjukdomar
Morbi infectiosi et parasitarii alii,
sequelae
B94.0
Sena effekter av trakom
B94.1
Sena effekter av virusencefalit
B94.2
Sena effekter av virushepatit
B94.8
Sena effekter av andra specificerade
infektionssjukdomar och
parasitsjukdomar
B94.9
Sena effekter av ospecificerad
infektionssjukdom eller
parasitsjukdom
B95.7
BAKTERIER, VIRUS OCH ANDRA
INFEKTIÖSA ORGANISMER (B95-B98)
Agentia infectiosa bacterialia, viralia et
alia
Koagulasnegativa stafylokocker
Anmärkning:
Dessa kategorier skall inte användas som
primärkoder (huvuddiagnoser) utan endast som
tilläggskoder (bidiagnoser) när man önskar att ange
den infektiösa organismen (eller organismerna) som
orsakar sjukdomar som klassificeras på annan plats
B95
Andra specificerade stafylokocker
som orsak till sjukdomar som
klassificeras i andra kapitel
B95.8
Ospecificerade stafylokocker som
orsak till sjukdomar som klassificeras
i andra kapitel
B96
Vissa andra specificerade
bakterier som orsak till
sjukdomar som klassificeras i
andra kapitel
Streptokocker och
stafylokocker som orsak till
sjukdomar som klassificeras i
andra kapitel
Alia bacteria quaedam specificata
morbos alibi classificatos
provocantia
Streptococcus et staphylococcus
morbum alibi classificatum
provocantes
B96.0
B95.0
Streptokocker grupp A som orsak till
sjukdomar som klassificeras i andra
kapitel
Mycoplasma pneumoniae som orsak
till sjukdomar som klassificeras i
andra kapitel
B96.1
B95.1
Streptokocker grupp B som orsak till
sjukdomar som klassificeras i andra
kapitel
Klebsiella pneumoniae som orsak till
sjukdomar som klassificeras i andra
kapitel
B96.2
B95.2
Streptokocker grupp D och
enterokocker som orsak till
sjukdomar som klassificeras i andra
kapitel
Escherichia coli som orsak till
sjukdomar som klassificeras i andra
kapitel
B96.3
Haemophilus influenzae som orsak till
sjukdomar som klassificeras i andra
kapitel
B95.3
Pneumokocker (Streptococcus
pneumoniae) som orsak till
sjukdomar som klassificeras i andra
kapitel
B96.4
Proteus (mirabilis) (morgagni) som
orsak till sjukdomar som klassificeras
i andra kapitel
B95.4
Andra specificerade streptokocker
som orsak till sjukdomar som
klassificeras i andra kapitel
B96.5
Pseudomonas (aeruginosa) som orsak
till sjukdomar som klassificeras i
andra kapitel
B95.5
Ospecificerade streptokocker som
orsak till sjukdomar som klassificeras
i andra kapitel
B96.6
Bacteroides fragilis som orsak till
sjukdomar som klassificeras i andra
kapitel
B95.6
Staphylococcus aureus som orsak till
sjukdomar som klassificeras i andra
kapitel
B96.7
Clostridium perfringens som orsak till
sjukdomar som klassificeras i andra
kapitel
69
B96.8
Andra specificerade bakterier som
orsak till sjukdomar som klassificeras
i andra kapitel
Utesluter:
Helicobacter pylori B98.0
Vibrio vulnificus B98.1
B97.8
Andra virus som orsak till sjukdomar
som klassificeras i andra kapitel
Humant metapneumovirus
B98
B96.8B
Acinetobacter som orsak till sjukdom
som klassificeras i andra kapitel
Andra specificerade infektiösa
organismer som orsak till
sjukdomar som klassificeras
på annan plats
B96.8C
Stenotrophomonas som orsak till
sjukdom som klassificeras i andra
kapitel
Alii organismi infectiosi specificati
morbos alibi classificatos
provocantes
B96.8W
Annan specificerad bakterie som orsak
till sjukdom som klassificeras i andra
kapitel
B97
Virus som orsak till sjukdomar
som klassificeras i andra
kapitel
Organismi virales morbum alibi
classificatum provocantes
B97.0
Adenovirus som orsak till sjukdomar
som klassificeras i andra kapitel
B97.1
Enterovirus som orsak till sjukdomar
som klassificeras i andra kapitel
Coxsackievirus
ECHO-virus
B97.2
Coronavirus som orsak till sjukdomar
som klassificeras i andra kapitel
B97.3
Retrovirus som orsak till sjukdomar
som klassificeras i andra kapitel
Lentevirus
Onkovirus
B97.4
Respiratoriskt syncytialvirus som
orsak till sjukdomar som klassificeras
i andra kapitel
B97.5
Reovirus som orsak till sjukdomar
som klassificeras i andra kapitel
B97.6
Parvovirus som orsak till sjukdomar
som klassificeras i andra kapitel
B97.7
Papillomvirus som orsak till
sjukdomar som klassificeras i andra
kapitel
70
B98.0
Helicobacter pylori [H.pylori] som
orsak till sjukdomar som klassificeras
på annan plats
B98.1
Vibrio vulnificus som orsak till
sjukdomar som klassificeras på annan
plats
ANDRA INFEKTIONSSJUKDOMAR (B99)
Alii morbi infectiosi
B99
Andra och ospecificerade
infektionssjukdomar
Alii morbi infectiosi non specificati
71
Kapitel 2
Tumörer (C00-D48)
Neoplasmata
Detta kapitel innehåller följande stora grupper av tumörer:
C00-C97 Maligna tumörer
C00-C75 Maligna tumörer med specificerad lokalisation, som konstaterats vara eller
förmodats vara primära. Undantagna är dock tumörer i lymfoid, blodbildande
och därmed besläktad vävnad.
C00-C14 Läpp, munhåla och svalg
C15-C26 Matsmältningsorganen
C30-C39 Andningsorganen och brösthålans organ
C40-C41 Ben och ledbrosk
C43-C44 Huden
C45-C49 Mesotelial vävnad och mjukvävnad
C50
Bröstkörtel
C51-C58 Kvinnliga könsorganen
C60-C63 Manliga könsorganen
C64-C68 Urinorganen
C69-C72 Öga, hjärnan och andra delar av centrala nervsystemet
C73-C75 Tyreoidea och andra endokrina körtlar
C76-C80 Maligna tumörer med ofullständigt angivna, sekundära och ospecificerade
lokalisationer
C81-C96 Maligna tumörer i lymfatisk, blodbildande och besläktad vävnad, som
konstaterats vara
eller förmodats vara primära
C97
Flera (primära) maligna tumörer med olika ursprung
D00-D09 Cancer in situ
D10-D36 Benigna tumörer
D37-D48 Tumörer av osäker eller okänd natur (se anmärkning före D37)
Anmärkningar:
1. Oklart definierade primära tumörer, sekundära tumörer (metastaser) och maligna
tumörer utan angiven lokalisation
Kategorierna C76-C80 innefattar även maligna tumörer där ursprungslokalisationen inte är klart
angiven eller där tumören beskrivs som ”disseminerad”, ”spridd” eller ”utspridd” utan att den
primära lokalisationen nämns. I båda fallen förutsätts ursprungslokalisationen vara okänd.
72
2. Funktionell aktivitet
Alla tumörer klassificeras i detta kapitel antingen de är funktionellt aktiva eller inte. Tilläggskod
från kapitel 4 kan användas för att ange funktionell aktivitet förenad med tumören. Så kan t ex ett
katekolaminproducerande malignt feokromocytom i binjurarna kodas under C74 med
tilläggskoden E27.5 och ett basofilt adenom i hypofysen med Cushings syndrom kodas under
D35.2 med tilläggskoden E24.0.
3. Morfologisk-histologisk bild
Det finns ett antal större morfologiska (histologiska) grupper av maligna tumörer:
• karcinom (innefattande skivepitelcancer och adenokarcinom)
• sarkom
• andra mjukvävnadstumörer innefattande mesoteliom
• lymfom (Hodgkin och non-Hodgkin)
• leukemi
• andra specificerade och lokalisationsspecifika typer
• ospecificerade cancerformer
Cancer är en generisk term och kan användas för alla ovanstående grupper även om termen sällan
används för maligna tumörer i lymfatisk, blodbildande och besläktad vävnad. ”Karcinom”
används ibland oriktigt som synonym för ”cancer”.
I kapitel 2 klassificeras tumörer företrädesvis efter lokalisation inom breda grupper med avseende
på tumörens natur (malignitetsgrad). Endast i undantagsfall anges morfologin i kategori- och
underkategorirubriker.
Den som önskar ange tumörens histologiska typ hänvisas till det särskilda avsnittet Morfologisk
(histologisk) klassifikation av tumörer i denna bok. Dessa morfologikoder är hämtade från andra
upplagan av The International Classification of Diseases for Oncology (ICD-O), vilken är en
klassifikation med två axlar som erbjuder ett klassificeringssystem för topografi och morfologi
oberoende av varandra. Morfologikoderna är sexställiga: de fyra första positionerna anger den
histologiska typen; den femte positionen anger malignitetsgraden (primärt malign, sekundärt
malign (genom metastaser), in situ, benign, osäkert om malign eller benign). Den sjätte positionen
anger differentieringsgraden hos solida tumörer och används också som en specialkod för lymfom
och leukemier.
4. Användning av underkategorier i kapitel 2
De bör uppmärksammas att fjärdepositionskoden .8 i detta kapitel fått en speciell användning (se
anmärkning 5). Där det blivit nödvändigt att använda undergrupper för ”andra” har i allmänhet
dessa hänförts till fjärdepositionskoden .7.
5. Maligna tumörer som går över lokalisationsgränser och användningen av
fjärdepositionskoden .8 (malign tumör med övergripande växt)
Kategorierna C00-C75 används för att klassificera primärt maligna tumörer med avseende på
deras ursprungslokalisation. Många treställiga kategorier indelas vidare med avseende på
namngivna anatomiska lokalisationer eller andra undergrupper av det aktuella organet. En tumör
som utbreder sig över två eller flera intilliggande undergrupper inom en treställig kategori och
vars ursprung ej kan fastställas, bör klassificeras under .8 (tumör med övergripande växt), om inte
kombinationen särskilt anges på annat ställe. Ett exempel på detta är att malign tumör i esofagus
73
och magsäck (med okänd ursprungslokalisation) hänförs till C16.0 (kardia), under det att malign
tumör på tungspetsen och tungans undersida (med okänd ursprungslokalisation) kodas under
C02.8. Däremot bör malign tumör som utgått från tungspetsen och som växt in i och involverat
tungans undersida hänföras till C02.1, eftersom ursprungslokalisationen (tungspetsen) är känd.
Övergripande växt innebär att de engagerade lokalisationerna ligger intill varandra. Undergrupper
som kommer efter varandra i nummerordning är ofta anatomiskt sett varandra närliggande.
För att klassificera tumörer med övergripande växt som går över de treställiga kategorierna inom
vissa organsystem har följande underkategorier bildats:
C02.8
C08.8
C14.8
C21.8
C24.8
C26.8
C39.8
C41.8
C49.8
C57.8
C63.8
C68.8
C72.8
Malign tumör i tungan med övergripande växt
Malign tumör i de stora spottkörtlarna med övergripande växt
Malign tumör i läpp, munhåla och farynx med övergripande växt
Malign tumör i rektum, anus och analkanalen med övergripande växt
Malign tumör i gallvägarna med övergripande växt
Malign tumör i matsmältningsorganen med övergripande växt
Malign tumör i respirationsorganen och brösthålans organ med övergripande växt
Malign tumör i ben och ledbrosk med övergripande växt
Malign tumör i bindväv och annan mjukvävnad med övergripande växt
Malign tumör i de kvinnliga könsorganen med övergripande växt
Malign tumör i de manliga könsorganen med övergripande växt
Malign tumör i urinorganen med övergripande växt
Malign tumör i hjärnan och andra delar av centrala nervsystemet med övergripande växt
Som exempel kan nämnas att en malign tumör i magsäcken och tunntarmen bör klassificeras
under C26.8, Malign tumör i matsmältningsorganen med övergripande växt.
6. Malign tumör i ektopisk vävnad
Maligna tumörer som utgår från ektopisk vävnad skall klassificeras efter den aktuella
lokalisationen. Det innebär t ex att ektopisk pankreatisk malign tumör i äggstock skall
klassificeras som tumör i äggstock (C56).
7. Användning av andra upplagan av International Classification of Diseases for Oncology
(ICD-O)
För vissa morfologiska tumörtyper ger kapitel 2 en begränsad topografisk klassifikation eller
ingen alls. I ICD-O används som topografikoder huvudsakligen samma tre- och fyrställiga
kategorier som i kapitel 2 används för primära maligna tumörer (C00-C77, C80). Härigenom får
man större specificitet i kodningen av lokalisationen även för tumörer av annan natur såsom
sekundära maligna tumörer (metastaser), benigna tumörer, in situ-tumörer och tumörer av oklar
eller okänd natur. WHO rekommenderar därför institutioner, som är särskilt intresserade av att
klassificera både tumörers lokalisation och morfologi, att använda ICD-O. Detta gäller t ex
cancerregister och patologiavdelningar. I Sverige används vid dessa institutioner i stor
utsträckning en snarlik klassifikation, nämligen Systematized Nomenclature of Medicine
(SNOMED), som också ger möjlighet att detaljerat klassificera tumörers lokalisation och
morfologi.
74
MALIGNA TUMÖRER (C00-C97)
C00.5
Neoplasmata maligna
Läppen, över- eller undersida ej
specificerad:
• buckalt
• i frenulum
• i slemhinnan
Tilläggskod (U85) kan användas för att ange resistens,
okänslighet och refraktära egenskaper hos tumörer mot
antineoplatstiska läkemedel
MALIGNA TUMÖRER MED
SPECIFICERAD LOKALISATION, SOM
KONSTATERATS VARA ELLER
FÖRMODATS VARA PRIMÄRA
(C00-C75).
Undantagna är dock tumörer i lymfoid,
blodbildande och därmed besläktad
vävnad, se C81-C96.
C00.6
Malign tumör i läppkommissuren (i
mungipan)
C00.8
Malign tumör i läpp med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
MALIGNA TUMÖRER I LÄPP, MUNHÅLA
OCH SVALG (C00-C14)
C00.9
Malign tumör i läpp, ospecificerad
C01
Malign tumör i tungbasen
Tungans bakre tredjedel
Tungbasens dorsala yta
Tungroten UNS
Malign tumör i läpp
C02
Neoplasma malignum labii
Utesluter:
Tumör på läpphuden (C43.0, C44.0)
C00.0
Malign tumör på överläppens
yttersida
C02.0
Malign tumör på underläppens
yttersida
C00.4
De främre två tredjedelarna av den
dorsala tungytan
Malign tumör på läppens yttersida,
över- eller underläpp ej specificerad
C02.1
Malign tumör på tungranden
Malign tumör på överläppens insida
C02.2
Malign tumör på tungans undersida
C02.3
Malign tumör i de främre två
tredjedelarna av tungan,
lokalisationen ej närmare specificerad
Inom eller på läpprödsgränsen
C00.3
Malign tumör på tungans översida
Utesluter:
Tungbasens dorsala yta (C01)
Inom eller på läpprödsgränsen
C00.2
Malign tumör i annan och
ospecificerad del av tungan
Neoplasma malignum partis
alterius et non specificatae
linguae
Inom eller på läpprödsgränsen
C00.1
Läpp UNS
Neoplasma malignum radicis
linguae
Neoplasmata maligna labii, cavi oris et
pharyngis
C00
Malign tumör på läppens insida, övereller underläpp ej specificerad
Överläppen:
• buckalt
• i frenulum
• i slemhinnan
Malign tumör på underläppens insida
Underläppen
• buckalt
• i frenulum
• i slemhinnan
Tungspetsen
De främre två tredjedelarna av den
ventrala tungytan
Frenulum linguae
Mellersta tredjedelen av tungan UNS
Tungans rörliga del UNS
75
C02.4
C05.1
Malign tumör i tungtonsillen
Utesluter:
Tonsill UNS (C09.9)
C02.8
Utesluter:
Rinofaryngeala ytan av mjuka gommen
(C11.3)
Malign tumör i tungan med
övergripande växt
Övergripande tungtumör vars ursprung ej
kan klassificeras under någon av
kategorierna C01-C02.4
C05.2
Malign tumör i uvula
C05.8
Malign gomtumör med övergripande
växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C02.9
C03
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Ospecificerad lokalisation av malign
tumör i tungan
C05.9
Malign tumör i tandköttet
C06
Utesluter:
Malign tumör utgående från tandvävnad
(C41.0-C41.1)
C03.0
Malign tumör i överkäkstandköttet
C03.1
Malign tumör i underkäkstandköttet
C03.9
Ospecificerad lokalisation av malign
tumör i tandköttet
C04
Malign tumör i munbotten
Neoplasma malignum fundi oris
C04.8
C06.0
Malign tumör i kindslemhinnan
C06.1
Malign tumör i muningången
C06.2
Malign tumör på retromolära ytan
C06.8
Malign muntumör med övergripande
växt
Malign tumör i främre delen av
munbotten
C06.9
Anmärkning:
Se anm 5 i inledning till detta kapitel
C05
Malign tumör i gom
C07
Ospecificerad lokalisation av malign
tumör i munhålan
Malign tumör i parotiskörtel
Neoplasma malignum glandulae
parotideae
Neoplasma malignum palati
C05.0
Kindfåra (övre) (nedre)
Läppfåra (övre) (nedre)
Vestibulum oris
De små spottkörtlarna, ospecificerad
lokalisation
Munhålan UNS
Malign tumör i munbotten med
övergripande växt
Ospecificerad lokalisation av malign
tumör i munbotten
Buckal mukosa UNS
Anmärkning:
Se anm 5 i inledning till detta kapitel
Malign tumör i laterala delen av
munbotten
C04.9
Malign tumör i annan och
ospecificerad del av munhålan
Neoplasma malignum partis
alterius et non specificatae oris
Framför premolar-hörntandsgränser
C04.1
Ospecificerad lokalisation av malign
tumör i gommen
Muntaket
Neoplasma malignum gingivae
C04.0
Malign tumör i mjuka gommen
Malign tumör i hårda gommen
76
C08
Malign tumör i andra och
ospecificerade stora
spottkörtlar
C10
Neoplasma malignum
oropharyngis
Neoplasma malignum
glandularum salivariarium
majorum aliarum et non
specificatarum
Utesluter:
Tonsill (C09)
Utesluter:
Maligna tumörer i de små spottkörtlarna
UNS (C06.9)
Maligna tumörer i specificerade små
spottkörtlar som
klassificeras efter sin anatomiska
lokalisation
Parotiskörtel (C07)
C08.0
C10.0
Malign tumör i vallecula epiglottica
(struplocksinsänkningen)
C10.1
Malign tumör på främre ytan av
epiglottis
Epiglottis, fria kanterna
Glossoepiglottiska vecket
Utesluter:
Epiglottis (suprahyoidala delen) UNS
(C32.1)
Malign tumör i
submandibulariskörtel
Submaxillariskörtel
C08.1
Malign tumör i sublingualiskörtel
C08.8
Malign tumör i de stora
spottkörtlarna med övergripande växt
Malign tumör i stora spottkörtlar vars
ursprung ej kan klassificeras under
någon av kategorierna C07-C08.1
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C08.9
Malign tumör i stor spottkörtel,
ospecificerad
C09
Malign tumör i tonsill
C10.2
Malign tumör i laterala väggen av
orofarynx
C10.3
Malign tumör i bakre väggen av
orofarynx
C10.4
Malign tumör i brankialvecket
C10.8
Malign tumör i orofarynx med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Utesluter:
Farynxtonsillen (C11.1)
Tungtonsillen (C02.4)
Malign tumör i fossa tonsillaris
C09.1
Malign tumör i gombåge (främre)
(bakre)
C09.8
Malign tonsilltumör med
övergripande växt
C10.9
Ospecificerad lokalisation av malign
tumör i orofarynx
C11
Malign tumör i rinofarynx (övre
svalgrummet)
Neoplasma malignum
rhinopharyngis
C11.0
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C09.9
Brankialcysta (som lokalisation för
tumör)
Gränsregionen
Övergången mellan den fria randen av
epiglottis, aryepiglottiska vecket och
faryngoepiteliala vecket
Neoplasma malignum tonsillae
C09.0
Malign tumör i orofarynx
(mellansvalget)
Malign tumör i övre väggen av
rinofarynx
Rinofarynxtaket
C11.1
Malign tumör i tonsill, ospecificerad
Gomtonsill
Tonsill UNS
Malign tumör i bakre väggen av
rinofarynx
Adenoiden
Farynxtonsillen
77
C11.2
Malign tumör i sidovägg av
rinofarynx
C13.9
Faryngeal ficka
Rosenmüllers ficka
Örontrumpetens öppning
C11.3
Hypofarynxväggen UNS
C14
Malign tumör i främre väggen av
rinofarynx
Bakre kanten av nässeptum och bakre
näsöppningen
Rinofaryngeala ytan av mjuka gommen
Rinofarynxgolvet
C11.8
C11.9
Malign tumör i rinofarynx med
övergripande växt
Utesluter:
Munhålan UNS (C06.9)
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C14.0
Ospecificerad lokalisation av malign
tumör i rinofarynx
Ospecificerad lokalisation av malign
tumör i farynx
C14.2
Malign tumör i Waldeyers ring
C14.8
Malign tumör i läpp, munhåla och
farynx med övergripande växt
Malign tumör i fossa piriformis
Neoplasma malignum recessus
piriformis
C13
Malign tumör med annan och
ofullständigt angiven
lokalisation i läpp, munhåla
och svalg
Neoplasma malignum loco alio et
male definito labii, cavi oris et
pharyngis
Rinofarynxväggen UNS
C12
Ospecificerad lokalisation av malign
tumör i hypofarynx
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Malign tumör i hypofarynx
(svalget i höjd med
struphuvudet)
Neoplasma malignum
hypopharyngis
Utesluter:
Fossa piriformis (C12)
C13.0
Malign tumör i postkrikoidala
rummet
C13.1
Malign tumör i aryepiglottiska vecket,
hypofaryngeala delen
Aryepiglottiska vecket, marginala zonen
och UNS
Utesluter:
Aryepiglottiska vecket, laryngeala delen
(C32.1)
C13.2
Malign tumör i bakre
hypofarynxväggen
C13.8
Malign tumör i hypofarynx med
övergripande växt
Malign tumör i läpp, munhåla och farynx
vars ursprung ej kan klassificeras under
någon av kategorierna C00-C14.2
Anmärkning:
Se anm 5 i inledningen till detta kapitel
78
MALIGNA TUMÖRER I
MATSMÄLTNINGSORGANEN (C15-C26)
Neoplasmata maligna organorum
digestionis
C15
Malign tumör i matstrupen
C16.1
Malign tumör i fundus ventriculi
C16.2
Malign tumör i corpus ventriculi
C16.3
Malign tumör i antrum ventriculi
C16.4
Malign tumör i pylorus
C16.5
Ospecificerad lokalisation av malign
tumör i ventrikelns curvatura minor
Neoplasma malignum oesophagi
Anmärkning:
I ICD-10 anges två alternativa
indelningar för tumörens lokalisation i
esofagus, en anatomisk beskrivning
(decimalerna .0-.2) och en uppdelning
efter tredjedelar (decimalerna .3-.5). För
svenskt bruk har det senare alternativet
valts, vilket återges nedan.
C15.3
Malign tumör i övre tredjedelen av
esofagus
Malign tumör i mellersta tredjedelen
av esofagus
C15.5
Malign tumör i nedre tredjedelen av
esofagus
C15.8
Malign tumör i esofagus med
övergripande växt
C16
Curvatura major om tumören ej
klassificeras under C16.0-C16.4
Malign tumör i duodenum
C17.1
Malign tumör i jejunum
C17.2
Malign tumör i ileum
Utesluter:
Ileocekalvalveln (C18.0)
Gastroesofageala gränszonen
Kardioesofageala gränszonen
Övre magmunnen
Malign tumör i gastroesofageala
gränszonen, Siewert typ II
C16.0C
Malign tumör i gastroesofageala
gränszonen, Siewert typ III
C16.0X
Malign tumör i kardia, ospecificerad
Siewert typ
Malign tumör i tunntarmen
C17.0
Malign tumör i kardia
C16.0B
Ospecificerad lokalisation av malign
tumör i magsäcken
Neoplasma malignum intestini
tenuis
Malign tumör i magsäcken
Malign tumör i gastroesofageala
gränszonen, Siewert typ I
Malign tumör i magsäcken med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C17
Ospecificerad lokalisation av malign
tumör i esofagus
C16.0A
Ospecificerad lokalisation av malign
tumör i ventrikelns curvatura major
Magsäckscancer UNS
Neoplasma malignum ventriculi
C16.0
C16.6
C16.9
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C15.9
Curvatura minor om tumören ej
klassificeras under C16.1-C16.4
C16.8
C15.4
Nedre magmunnen
Pyloruskanalen
C17.3
Malign tumör i Meckels divertikel
C17.8
Malign tumör i tunntarmen med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C17.9
79
Ospecificerad lokalisation av malign
tumör i tunntarmen
C18
Malign tumör i tjocktarmen
Neoplasma malignum coli
C21.1
Malign tumör i analkanalen
C18.0
Malign tumör i caecum
C21.2
Malign tumör i kloakogena zonen
C18.1
Malign tumör i appendix
C21.8
Malign tumör i rektum, anus och
analkanalen med övergripande växt
C18.2
Malign tumör i colon ascendens
C18.3
Malign tumör i flexura hepatica
C18.4
Malign tumör i colon transversum
C18.5
Malign tumör i flexura lienalis
C18.6
Malign tumör i colon descendens
C18.7
Malign tumör i sigmoideum
Ileocekalvalveln
Anorectum
Anorektala gränszonen
Malign tumör i rektum, anus och
analkanal vars ursprung ej kan hänföras
till någon av kategorierna C20-C21.2
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C22
Malign tumör i kolon med
övergripande växt
Utesluter:
Gallgångarna UNS (C24.9)
Sekundär malign tumör i levern (C78.7)
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C18.9
C20
C22.0
Levercellskarcinom
C22.1
Cancer i intrahepatiska gallgångarna
C22.2
Hepatoblastom
C22.3
Angiosarkom i levern
C22.4
Andra sarkom i levern
C22.7
Andra specificerade primära
cancerformer i levern
C22.9
Ospecificerad malign tumör i levern
C23
Malign tumör i gallblåsan
Ospecificerad lokalisation av malign
tumör i kolon
Tjocktarmen UNS
C19
Malign tumör i rektosigmoidala
gränszonen
Neoplasma malignum junctionis
rectosigmoidalis
Malign tumör i ändtarmen
Neoplasma malignum recti
Ampulla recti
C21
Malign tumör i anus och
analkanalen
Neoplasma malignum ani et
canalis analis
C21.0
Malign tumör i levern och
intrahepatiska gallgångarna
Neoplasma malignum hepatis et
ductulorum biliferorum
intrahepaticorum
Utesluter:
Rektosigmoidala gränszonen (C19)
C18.8
Analsfinktern
Sphincter ani
Hepatocellulär cancer
Malignt hepatom
Kupfercellssarkom
Neoplasma malignum vesicae
felleae
Ospecificerad lokalisation av malign
tumör i anus
Utesluter:
Anala gränszonen (C43.5, C44.5)
Analhuden (C43.5, C44.5)
Perianala huden (C43.5, C44.5)
80
C24
Malign tumör i andra och
ospecificerade delar av
gallvägarna
C25.8
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Neoplasma malignum partium
aliarum et non specificatarum
viarum biliarium
Utesluter:
Intrahepatiska gallgångarna (C22.1)
C24.0
C25.9
Ospecificerad lokalisation av malign
tumör i pankreas
C26
Malign tumör med annan och
ofullständigt angiven
lokalisation i matsmältningsorganen
Malign tumör i extrahepatiska
gallgångarna
Ductus choledochus
Ductus cysticus
Ductus hepaticus
Gallgång UNS
Gallvägar UNS
C24.1
Malign tumör i ampulla Vateri
C24.8
Malign tumör i gallvägarna med
övergripande växt
Neoplasma malignum organorum
digestionis loco alio et male
definito
Utesluter:
Peritoneum och retroperitoneum (C48.-)
C26.0
Malign tumör i gallvägarna vars
ursprung ej kan hänföras till någon av
kategorierna C22.0-C24.1
Malign tumör som engagerar både
intrahepatiska och extrahepatiska
gallgångarna
C25
C26.1
C26.8
Malign tumör i pankreas
C25.1
Malign tumör i corpus pancreatis
C25.2
Malign tumör i cauda pancreatis
C25.3
Malign tumör i ductus pancreatis
C25.4
Malign tumör i pankreas endokrina
del
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Utesluter:
Kardioesofageala gränszonen (C16.0)
C26.9
Ofullständigt angiven lokalisation av
malign tumör i matsmältningsorganen
Digestionsorganen UNS
Gastrointestinalkanalen UNS
Langerhanska öarna
C25.7
Malign tumör i matsmältningsorganen med övergripande växt
Malign tumör i matsmältningsorganen
vars ursprung ej kan hänföras till någon
av kategorierna C15-C26.1
Neoplasma malignum pancreatis
Malign tumör i caput pancreatis
Malign tumör i mjälten
Utesluter:
Follikulärt lymfom (C82.-)
Hodgkins lymfom (C81.-)
Icke-follikulärt lymfom (C83.-)
Mogna T/NK-cellslymfom (C84.-)
Non-Hodgkin-lymfom, andra och
ospecificerade typer (C85.-)
Ospecificerad lokalisation av malign
tumör i gallvägarna
C25.0
Ospecificerad lokalisation av malign
tumör i tarmkanalen
Tarmen UNS
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C24.9
Malign tumör i pankreas med
övergripande växt
Malign tumör i pankreas med andra
lokalisationer
Pankreashalsen
81
MALIGNA TUMÖRER I
ANDNINGSORGANEN OCH
BRÖSTHÅLANS ORGAN (C30-C39)
C31.8
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Neoplasmata maligna systematis
respirationis et organorum
intrathoracalium
Innefattar:
Mellanörat
Utesluter:
Mesoteliom (C45.-)
C30
Malign tumör i näshåla och
mellanöra
C32
Malign tumör i struphuvudet
C32.0
Malign tumör i glottis
C32.1
Malign tumör i supraglottis
Inre näsrummet
Näsbrosk
Näsmusslor
Nässeptum
Vestibulum nasi
Malign tumör i mellanöra och
inneröra
Örontrumpeten
Utesluter:
Hörselgångens ben (C41.0)
Ytterörats hud (C43.2, C44.2)
Yttre hörselgång (C43.2, C44.2)
Öronbrosk (C49.0)
C31
Malign tumör i näsans bihålor,
ospecificerade
Malign tumör i näshåla
Utesluter:
Bakre randen av nässeptum, näsmusslor
och bakre näsöppningen (C11.3)
Bulbus olfactorius (C72.2)
Näsan UNS (C76.0)
Näsben (C41.0)
Näshuden (C43.3, C44.3)
C30.1
C31.9
Neoplasma malignum laryngis
Neoplasma malignum cavi nasi et
auris mediae
C30.0
Neoplasma malignum sinuum
paranasalium
Malign tumör i maxillarsinus
C31.1
Malign tumör i etmoidalsinus
C31.2
Malign tumör i frontalsinus
C31.3
Malign tumör i sfenoidalsinus
Stämband UNS
Äkta stämbanden
Aryepiglottiska vecket, laryngeala delen
Bakre (laryngeala) ytan av epiglottis
Epiglottis (suprahyoidala delen) UNS
Falska stämbanden
Ventriculus laryngis
Yttre larynx
Utesluter:
Aryepiglottiska vecket:
• gränszonen (C13.1)
• hypofarynxdelen (C13.1)
• UNS (C13.1)
Främre ytan av epiglottis (C10.1)
C32.2
Malign tumör i subglottis
C32.3
Malign tumör i larynxbrosk
C32.8
Malign tumör i larynx med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Malign tumör i näsans bihålor
C31.0
Malign tumör i näsans bihålor med
övergripande växt
C32.9
Ospecificerad lokalisation av malign
tumör i larynx
C33
Malign tumör i luftstrupen
Neoplasma malignum tracheae
C34
Malign tumör i bronk och lunga
Neoplasma malignum bronchi et
pulmonis
C34.0
82
Malign tumör i huvudbronk
Carina
Hilus
C38.0
C34.1
Malign tumör i överlob, bronk eller
lunga
C34.2
Malign tumör i mellanlob, bronk eller
lunga
C34.3
Malign tumör i underlob, bronk eller
lunga
C34.8
Perikardiet
Utesluter:
De stora kärlen (C49.3)
C38.1
Malign tumör i främre mediastinum
C38.2
Malign tumör i bakre mediastinum
Malign tumör i bronk och lunga med
övergripande växt
C38.3
Malign tumör i ospecificerad del av
mediastinum
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C38.4
Malign tumör i pleura
Utesluter:
Mesoteliom i pleura (C45.0)
C34.9
Ospecificerad lokalisation av malign
tumör i bronk och lunga
C34.9A
Lungcancer, skivepitelcancer
C34.9B
Lungcancer, småcellig cancer
C34.9C
Lungcancer, adenocarcinom
C34.9D
Lungcancer, bronkioalveolär cancer
C34.9E
Lungcancer, storcellig cancer
C34.9F
Lungcancer, adenoskvamös cancer
C34.9G
Lungcancer, odifferentierad cancer (icke
småcellig)
C34.9H
Lungcancer, karcinoid
C34.9J
Lungcancer, mukoepidermoid cancer
C34.9K
Lungcancer, adenoidcystisk cancer
C34.9X
Lungcancer, ospecificerad typ
C37
Malign tumör i tymus
C38.8
Malign tumör i hjärtat, mediastinum
och pleura med övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C39
Maligna tumörer med annan
och ofullständigt angiven
lokalisation i andningsorganen
och brösthålans organ
Neoplasmata maligna systematis
respiratorii et organorum
intrathoracalium loco alio et male
definito
Utesluter:
Intratorakala organ UNS (C76.1)
Torakala organ UNS (C76.1)
C39.0
Ospecificerad lokalisation av malign
tumör i övre luftvägarna
C39.8
Malign tumör i respirationsorganen
och brösthålans organ med
övergripande växt
Malign tumör i respirationsorgan och
intratorakala organ vars ursprung ej kan
hänföras till någon av kategorierna C30C39.0
Neoplasma malignum thymi
C38
Malign tumör i hjärtat
Malign tumör i hjärtat,
mediastinum
(lungmellanrummet) och
lungsäcken
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C39.9
Neoplasma malignum cordis,
mediastini et pleurae
Ofullständigt angivna lokalisationer
av malign tumör inom
andningsorganen
Andningsorganen UNS
Utesluter:
Mesoteliom (C45.-)
83
C41.0
MALIGNA TUMÖRER I BEN OCH
LEDBROSK (C40-C41)
Orbitalben
Överkäksben
Neoplasmata maligna ossium et
cartilaginum
Utesluter:
Karcinom, alla typer utom de som utgår
från
ben- eller tandvävnad, i:
• maxillarsinus (C31.0)
• överkäke (tandköttet) (C03.0)
Underkäksben (C41.1)
Utesluter:
Benmärg UNS (C96.7)
Synovialmembran (C49.-)
C40
Malign tumör i skallens ben och
ansiktsbenen
Malign tumör i ben och
extremitetsledbrosk
C41.1
Neoplasma malignum ossis et
cartilaginis articularis
extremitatum
Malign tumör i underkäkens ben
Mandibel
Utesluter:
Karcinom, alla typer utom de som utgår
från
ben- eller tandvävnad, i:
• käke (tandköttet) UNS (C03.9)
• underkäke (tandköttet) (C03.1)
Överkäksben (C41.0)
C40.0
Malign tumör i skapula och övre
extremiteternas långa ben
C40.1
Malign tumör i övre extremiteternas
korta ben
C40.2
Malign tumör i nedre extremiteternas
långa ben
C40.3
Malign tumör i nedre extremiteternas
korta ben
C41.3
Malign tumör i revben, sternum och
klavikel
C40.8
Malign tumör i extremiteternas ben
och ledbrosk med övergripande växt
C41.4
Malign tumör i bäckenben, sakrum
och koccyx
C41.8
Malign tumör i ben och ledbrosk med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C40.9
Ospecificerad lokalisation av malign
tumör i extremiteternas ben och
ledbrosk
C41
Malign tumör i ben och
ledbrosk med annan och
ospecificerad lokalisation
C41.2
Malign tumör i kotpelaren
Utesluter:
Sakrum och koccyx (C41.4)
Malign tumör i ben och ledbrosk vars
ursprung ej kan hänföras till någon av
kategorierna C40-C41.4
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C41.9
Neoplasma malignum ossis et
cartilaginis articularis loco alio et
non specificato
Utesluter:
Brosket i :
• extremiteter (C40.-)
• larynx (C32.3)
• näsan (C30.0)
• örat (C49.0)
Extremitetsbenen (C40.-)
84
Ospecificerad lokalisation av malign
tumör i ben och ledbrosk
MELANOM OCH ANDRA MALIGNA
TUMÖRER I HUDEN (C43-C44)
C43.2B
Desmoplastiskt malignt melanom på
ytteröra och i yttre hörselgång
Melanoma et alia neoplasmata maligna
cutis
C43.2C
Lentigo maligna-melanom på ytteröra
och i yttre hörselgång
C43
C43.2D
Nodulärt malignt melanom på ytteröra
och i yttre hörselgång
C43.2F
Ytligt spridande malignt melanom på
ytteröra och i yttre hörselgång
C43.2X
Ospecificerat malignt melanom på
ytteröra och i yttre hörselgång
C43.3
Malignt melanom på andra och
ospecificerade delar av ansiktet
C43.3B
Desmoplastiskt malignt melanom på
andra och ospecificerade delar av
ansiktet
C43.3C
Lentigo maligna-melanom på andra och
ospecificerade delar av ansiktet
C43.3D
Nodulärt malignt melanom på andra och
ospecificerade delar av ansiktet
C43.3F
Ytligt spridande malignt melanom på
andra och ospecificerade delar av
ansiktet
C43.3X
Ospecificerat malignt melanom på andra
och ospecificerade delar av ansiktet
C43.4
Malignt melanom i hårbotten och på
halsen
C43.4B
Desmoplastiskt malignt melanom i
hårbotten och på halsen
C43.4C
Lentigo maligna-melanom i hårbotten
och på halsen
C43.4D
Nodulärt malignt melanom i hårbotten
och på halsen
C43.4F
Ytligt spridande malignt melanom i
hårbotten och på halsen
C43.4X
Ospecificerat malignt melanom i
hårbotten och på halsen
Malignt melanom i huden
Melanoma malignum cutis
Innefattar:
Morfologikoderna M872 - M879 med
malignitetskod /3
Utesluter:
Malignt melanom på könsorganen (C51C52, C60.-, C63.-)
C43.0
Malignt melanom på läpp
Utesluter:
På läpprödsgränsen (C00.0-C00.2)
C43.0B
Desmoplastiskt malignt melanom på
läpp
C43.0C
Lentigo maligna-melanom på läpp
C43.0D
Nodulärt malignt melanom på läpp
C43.0F
Ytligt spridande malignt melanom på
läpp
C43.0X
Ospecificerat malignt melanom på läpp
C43.1
Malignt melanom på ögonlock
inklusive ögonvrå
C43.1B
Desmoplastiskt malignt melanom på
ögonlock inklusive ögonvrå
C43.1C
Lentigo maligna-melanom på ögonlock
inklusive ögonvrå
C43.1D
Nodulärt malignt melanom på ögonlock
inklusive ögonvrå
C43.1F
Ytligt spridande malignt melanom på
ögonlock inklusive ögonvrå
C43.1X
Ospecificerat malignt melanom på
ögonlock inklusive ögonvrå
C43.2
Malignt melanom på ytteröra och i
yttre hörselgång
85
C43.5
Malignt melanom på bålen
Anala gränszonen
Analhuden
Huden i axill
Huden i ljumske
Huden omkring anus
Huden över bröstkörtel
Utesluter:
Anus UNS (C21.0)
C43.5B
Desmoplastiskt malignt melanom på
bålen
C43.5C
Lentigo maligna-melanom på bålen
C43.5D
Nodulärt malignt melanom på bålen
C43.5F
Ytligt spridande malignt melanom på
bålen
C43.5X
Ospecificerat malignt melanom på bålen
C43.6
Malignt melanom på övre extremitet
inklusive skuldran
C43.6A
C43.6B
C43.6C
C43.6D
C43.7C
Lentigo maligna-melanom på nedre
extremitet inklusive höften
C43.7D
Nodulärt malignt melanom på nedre
extremitet inklusive höften
C43.7E
Subungualt malignt melanom på nedre
extremitet inklusive höften
C43.7F
Ytligt spridande malignt melanom på
nedre extremitet inklusive höften
C43.7X
Ospecificerat malignt melanom på nedre
extremitet inklusive höften
C43.8
Malignt melanom i huden med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Akralt lentiginöst malignt melanom på
övre extremitet inklusive skuldran
Desmoplastiskt malignt melanom på
övre extremitet inklusive skuldran
Lentigo maligna-melanom på övre
extremitet inklusive skuldran
Nodulärt malignt melanom på övre
extremitet inklusive skuldran
C43.6E
Subungualt malignt melanom på övre
extremitet inklusive skuldran
C43.6F
Ytligt spridande malignt melanom på
övre extremitet inklusive skuldran
C43.6X
Ospecificerat malignt melanom på övre
extremitet inklusive skuldran
C43.7
Malignt melanom på nedre extremitet
inklusive höften
C43.7A
Akralt lentiginöst malignt melanom på
nedre extremitet inklusive höften
C43.7B
Desmoplastiskt malignt melanom på
nedre extremitet inklusive höften
C43.8B
Desmoplastiskt malignt melanom i
huden med övergripande växt
C43.8C
Lentigo maligna-melanom i huden med
övergripande växt
C43.8D
Nodulärt malignt melanom i huden med
övergripande växt
C43.8F
Ytligt spridande malignt melanom i
huden med övergripande växt
C43.8X
Ospecificerat malignt melanom i huden
med övergripande växt
C43.9
Ospecificerad lokalisation av malignt
melanom i huden
Malignt melanom UNS
86
C43.9A
Akralt lentiginöst melanom i huden med
ospecificerad lokalisation
C43.9B
Desmoplastiskt malignt melanom i
huden med ospecificerad lokalisation
C43.9C
Lentigo maligna-melanom i huden med
ospecificerad lokalisation
C43.9D
Nodulärt melanom i huden med
ospecificerad lokalisation
C43.9E
Subungualt malignt melanom med
ospecificerad lokalisation
C43.9F
Ytligt spridande melanom i huden med
ospecificerad lokalisation
C44.1E
Ospecificerad basalcellscancer i huden
på ögonlock inklusive ögonvrå
C43.9X
Ospecificerat malignt melanom i huden
med ospecificerad lokalisation
C44.1S
Skivepitelcancer i huden på ögonlock
inklusive ögonvrå
C44
Andra maligna tumörer i huden
C44.1W
Andra maligna tumörer i huden på
ögonlock inklusive ögonvrå
C44.1X
Ospecificerad malign tumör i huden på
ögonlock inklusive ögonvrå
C44.2
Malign tumör i huden på ytteröra och
i yttre hörselgången
Alia neoplasmata maligna cutis
Innefattar:
Basalcellscancer i huden
Malign tumör i talgkörtlar och
svettkörtlar
Skivepitelcancer i huden
Utesluter:
Huden på könsorganen (C51-C52, C63.-,
C60.-)
Kaposis sarkom (C46.-)
Malignt melanom i huden (C43.-)
Utesluter:
Örats bindväv (C49.0)
C44.2B
Ytligt växande basalcellscancer i huden
på ytteröra och i yttre hörselgången
Malign tumör i läpphuden
C44.2C
Morfealiknande basalcellscancer i huden
på ytteröra och i yttre hörselgången
Utesluter:
Malign tumör i läpp (C00.-)
C44.2D
Annan basalcellscancer i huden på
ytteröra och i yttre hörselgången
C44.0B
Ytligt växande basalcellscancer i
läpphuden
C44.2E
Ospecificerad basalcellscancer i huden
på ytteröra och i yttre hörselgången
C44.0C
Morfealiknande basalcellscancer i
läpphuden
C44.2S
Skivepitelcancer i huden på ytteröra och
i yttre hörselgången
C44.0D
Annan basalcellscancer i läpphuden
C44.2W
C44.0E
Ospecificerad basalcellscancer i
läpphuden
Andra maligna tumörer i huden på
ytteröra och i yttre hörselgången
C44.2X
C44.0S
Skivepitelcancer i läpphuden
Ospecificerad malign tumör i huden på
ytteröra och i yttre hörselgången
C44.0W
Andra maligna tumörer i läpphuden
C44.3
Malign tumör i huden på andra och
ospecificerade delar av ansiktet
C44.0X
Ospecificerad malign tumör i läpphuden
C44.3B
C44.1
Malign tumör i huden på ögonlock
inklusive ögonvrå
Ytligt växande basalcellscancer i huden
på andra och ospecificerade delar av
ansiktet
C44.3C
Morfealiknande basalcellscancer i huden
på andra och ospecificerade delar av
ansiktet
C44.3D
Annan basalcellscancer i huden på andra
och ospecificerade delar av ansiktet
C44.3E
Ospecificerad basalcellscancer i huden
på andra och ospecificerade delar av
ansiktet
C44.0
Basalcellscancer på läpp
Utesluter:
Ögonlockets bindväv (C49.0)
C44.1B
C44.1C
C44.1D
Ytligt växande basalcellscancer i huden
på ögonlock inklusive ögonvrå
Morfealiknande basalcellscancer i huden
på ögonlock inklusive ögonvrå
Annan basalcellscancer i huden på
ögonlock inklusive ögonvrå
87
C44.5S
Skivepitelcancer i huden på bålen
C44.5W
Andra maligna tumörer i huden på bålen
C44.5X
Ospecificerad malign tumör i huden på
bålen
C44.6
Malign tumör i huden på övre
extremiteten inklusive skuldran
Malign tumör i huden i hårbotten och
på halsen
C44.6B
Ytligt växande basalcellscancer i huden
på övre extremiteten inklusive skuldran
C44.4B
Ytligt växande basalcellscancer i huden
i hårbotten och på halsen
C44.6C
Morfealiknande basalcellscancer i huden
på övre extremiteten inklusive skuldran
C44.4C
Morfealiknande basalcellscancer i huden
i hårbotten och på halsen
C44.6D
Annan basalcellscancer i huden på övre
extremiteten inklusive skuldran
C44.4D
Annan basalcellscancer i huden i
hårbotten och på halsen
C44.6E
Ospecificerad basalcellscancer i huden
på övre extremiteten inklusive skuldran
C44.4E
Ospecificerad basalcellscancer i huden i
hårbotten och på halsen
C44.6S
Skivepitelcancer i huden på övre
extremiteten inklusive skuldran
C44.4S
Skivepitelcancer i huden i hårbotten och
på halsen
C44.6W
Andra maligna tumörer i huden på övre
extremiteten inklusive skuldran
C44.4W
Andra maligna tumörer i huden i
hårbotten och på halsen
C44.6X
Ospecificerad malign tumör i huden på
övre extremiteten inklusive skuldran
C44.4X
Ospecificerad malign tumör i huden i
hårbotten och på halsen
C44.7
Malign tumör i huden på nedre
extremiteten inklusive höften
C44.5
Malign tumör i huden på bålen
C44.7B
Ytligt växande basalcellscancer i huden
på nedre extremiteten inklusive höften
C44.7C
Morfealiknande basalcellscancer i huden
på nedre extremiteten inklusive höften
C44.7D
Annan basalcellscancer i huden på nedre
extremiteten inklusive höften
C44.7E
Ospecificerad basalcellscancer i huden
på nedre extremiteten inklusive höften
C44.7S
Skivepitelcancer i huden på nedre
extremiteten inklusive höften
C44.7W
Andra maligna tumörer i huden på nedre
extremiteten inklusive höften
C44.7X
Ospecificerad malign tumör i huden på
nedre extremiteten inklusive höften
C44.3S
Skivepitelcancer i huden på andra och
ospecificerade delar av ansiktet
C44.3W
Andra maligna tumörer i huden på andra
och ospecificerade delar av ansiktet
C44.3X
Ospecificerad malign tumör i huden på
andra och ospecificerade delar av
ansiktet
C44.4
Anala gränszonen
Analhuden
Huden i axill
Huden i ljumske
Huden omkring anus
Huden över bröstkörtel
Utesluter:
Anus UNS (C21.0)
C44.5B
Ytligt växande basalcellscancer i huden
på bålen
C44.5C
Morfealiknande basalcellscancer i huden
på bålen
C44.5D
Annan basalcellscancer i huden på bålen
C44.5E
Ospecificerad basalcellscancer i huden
på bålen
88
C44.9Q
Verrukös cancer i huden med
ospecificerad lokalisation
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C44.9R
Annan epitelial malign tumör i huden
med ospecificerad lokalisation
C44.8B
Ytligt växande basalcellscancer i huden
med övergripande växt
C44.9S
Skivepitelcancer i huden med
ospecificerad lokalisation
C44.8C
Morfealiknande basalcellscancer i huden
med övergripande växt
C44.9W
Andra maligna tumörer i huden med
ospecificerad lokalisation
C44.8D
Annan basalcellscancer i huden med
övergripande växt
C44.9X
Ospecificerad malign tumör i huden
med ospecificerad lokalisation
C44.8E
Ospecificerad basalcellscancer i huden
med övergripande växt
C44.8S
Skivepitelcancer i huden med
övergripande växt
C44.8W
Andra maligna tumörer i huden med
övergripande växt
C44.8X
Ospecificerad malign tumör i huden
med övergripande växt
C44.9
Ospecificerad lokalisation av malign
tumör i huden
C44.9A
Fibroepiteliom i huden med
ospecificerad lokalisation
C44.9B
Ytligt växande basalcellscancer med
ospecificerad lokalisation
C44.9C
Morfealiknande basalcellscancer med
ospecificerad lokalisation
C44.9D
Annan basalcellscancer med
ospecificerad lokalisation
C44.9E
Ospecificerad basalcellscancer med
ospecificerad lokalisation
C44.9H
Svettkörtelcancer med ospecificerad
lokalisation
C44.9J
Talgkörtelcancer i huden med
ospecificerad lokalisation
C44.9K
Annan malign adnextumör i huden med
ospecificerad lokalisation
C44.9L
Ospecificerad malign adnextumör i
huden med ospecificerad lokalisation
C44.8
Malign tumör i huden med
övergripande växt
89
MALIGNA TUMÖRER I MESOTELIAL
(KROPPSHÅLETÄCKANDE) VÄVNAD
OCH MJUKVÄVNAD (C45-C49)
Neoplasmata maligna telarum
mesothelialium et telarum mollium
C45
Mesoteliom
Mesothelioma
C46.7
Kaposis sarkom med andra
specificerade lokalisationer
C46.8
Kaposis sarkom i multipla organ
C46.9
Ospecificerad lokalisation av Kaposis
sarkom
C47
Malign tumör i perifera nerver
och autonoma nervsystemet
Innefattar:
Morfologikod M905 med malignitetskod
/3
C45.0
Neoplasma malignum nervorum
periphericorum et systematis
nervosi autonomici
Mesoteliom i pleura
Innefattar:
Sympatiska och parasympatiska nerver
och ganglier
Utesluter:
Andra maligna tumörer i pleura (C38.4)
C45.1
Mesoteliom i peritoneum
C47.0
Mesenteriet
Mesokolon
Omentet
Peritoneum (parietale) (pelvis)
Utesluter:
Perifera nerver i orbita (C69.6)
Utesluter:
Andra maligna tumörer i peritoneum
(C48.-)
C45.2
Malign tumör i perifera nerver i
huvudet, ansiktet och halsen
Mesoteliom i perikardiet
Utesluter:
Andra maligna tumörer i perikardiet
(C38.0)
C47.1
Malign tumör i perifera nerver i övre
extremitet inklusive skuldran
C47.2
Malign tumör i perifera nerver i
nedre extremitet inklusive höften
C47.3
Malign tumör i perifera nerver i torax
C47.4
Malign tumör i perifera nerver i
buken
C45.7
Mesoteliom med andra lokalisationer
C45.9
Ospecificerad lokalisation av
mesoteliom
C47.5
Malign tumör i perifera nerver i
bäckenet
C46
Kaposis sarkom
C47.6
Malign tumör i perifera nerver i bålen
i ospecificerad del
C47.8
Malign tumör i perifera nerver och
autonoma nervsystemet med
övergripande växt
Sarcoma Kaposi
Innefattar:
Morfologikod M9140 med
malignitetskod /3
C46.0
Kaposis sarkom i huden
C46.1
Kaposis sarkom i mjukvävnad
C46.2
Kaposis sarkom i gommen
C46.3
Kaposis sarkom i lymfkörtlar
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C47.9
90
Ospecificerad lokalisation av malign
tumör i perifera nerver och autonoma
nervsystemet
C48
Malign tumör i bukhinnan och
retroperitonealrummet
(utrymmet bakom bukhinnan)
Neoplasma malignum peritonei et
spatii retroperitonealis
Utesluter:
Kaposis sarkom (C46.1)
Mesoteliom (C45.-)
C48.0
C48.1
Malign tumör i
retroperitonealrummet
C48.2
Ospecificerad lokalisation av malign
tumör i peritoneum
C48.8
Malign tumör i peritoneum och
retroperitoneum med övergripande
växt
Malign tumör i bindväv och
mjukvävnad i huvudet, ansiktet och
halsen
Brosk och bindväv i ögonlock och öra
Utesluter:
Bindväv i orbita (C69.6)
C49.1
Malign tumör i bindväv och
mjukvävnad i övre extremitet
inklusive skuldran
C49.2
Malign tumör i bindväv och
mjukvävnad i nedre extremitet
inklusive höften
C49.3
Malign tumör i bindväv och
mjukvävnad i bröstkorgen
Malign tumör i peritoneum med
specificerad lokalisation
Bäckenperitoneum
Mesenterium
Mesokolon
Oment
Peritoneum parietale
Axill
Diafragma
Stora kärl
Utesluter:
Bröstkörtel (C50.-)
Hjärtat (C38.0)
Mediastinum (C38.1-C38.3)
Tymus (C37)
C49.4
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C49
C49.0
Malign tumör i bindväv och
mjukvävnad i buken
Bukväggen
Hypokondriet
Malign tumör i annan bindväv
och mjukvävnad
C49.5
Neoplasma malignum alterius
telae connectivae et telae mollis
Malign tumör i bindväv och
mjukvävnad i bäckenet
Ljumske
Perineum
Sätet
Innefattar:
Blodkärl
Brosk
Bursa
Fascia
Fettvävnad
Ligament (utom uterina)
Lymfkärl
Muskel
Sena (senskida)
Synovialmembran
C49.6
Malign tumör i bindväv och
mjukvävnad på bålen med
ospecificerad lokalisation
Ryggen UNS
C49.8
Malign tumör i bindväv och annan
mjukvävnad med övergripande växt
Malign tumör i bindväv och mjukvävnad
vars ursprung ej kan hänföras till någon
av kategorierna C47-C49.6
Utesluter:
Bindväv i bröstkörtel (C50.-)
Kaposis sarkom (C46.-)
Larynxbrosk (C32.3)
Ledbrosk (C40-C41)
Mesoteliom (C45.-)
Näsbrosk (C30.0)
Perifera nerver och autonoma
nervsystemet (C47.-)
Peritoneum (C48.-)
Retroperitoneum (C48.-)
Anmärkning:
Se anm 5 i inledningen till detta kapitel
91
C49.9
MALIGN TUMÖR I BRÖSTKÖRTEL (C50)
Ospecificerad lokalisation av malign
tumör i bindväv och mjukvävnad
C49.9A
Hemangiosarkom med ospecificerad
lokalisation
C49.9B
Lymfangiosarkom med ospecificerad
lokalisation
Neoplasma malignum mammae
C50
Malign tumör i bröstkörtel
Neoplasma malignum mammae
Innefattar:
Bindväv i bröstkörtel
C49.9C
Endovaskulärt papillärt angioendoteliom
med ospecificerad lokalisation
C49.9D
Enzingers epitelioidsarkom med
ospecificerad lokalisation
C50.0
Malign tumör i bröstvårta och
vårtgård
C49.9E
Fibrosarkom med ospecificerad
lokalisation
C50.1
Malign tumör i centrala delen av
bröstkörteln
C49.9F
Liposarkom med ospecificerad
lokalisation
C50.2
Malign tumör i övre inre kvadranten
av bröstkörteln
C49.9G
Myxosarkom med ospecificerad
lokalisation
C50.3
Malign tumör i nedre inre kvadranten
av bröstkörteln
C49.9H
Synovialt sarkom med ospecificerad
lokalisation
C50.4
Malign tumör i övre yttre kvadranten
av bröstkörteln
C49.9J
Leiomyosarkom med ospecificerad
lokalisation
C50.5
Malign tumör i nedre yttre
kvadranten av bröstkörteln
C49.9K
Embryonalt rabdomyosarkom med
ospecificerad lokalisation
C50.6
Malign tumör i axillary tail of breast
(axillflik)
C49.9L
Malignt granulärcellsmyoblastom med
ospecificerad lokalisation
C50.8
Malign tumör i bröstkörtel med
övergripande växt
C49.9M
Alveolärt mjukdelssarkom med
ospecificerad lokalisation
C49.9N
Klarcellssarkom med ospecificerad
lokalisation
C49.9W
Andra maligna tumörer i bindväv och
mjukvävnad med ospecificerad
lokalisation
C49.9X
Ospecificerad malign tumör i
bindvävnad och mjukvävnad med
ospecificerad lokalisation
Utesluter:
Huden över bröstkörteln (C43.5, C44.5)
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C50.9
92
Ospecificerad lokalisation av malign
tumör i bröstkörtel
MALIGNA TUMÖRER I DE KVINNLIGA
KÖNSORGANEN (C51-C58)
C54
Neoplasmata maligna genitalium
feminae
Malign tumör i
livmoderkroppen
Neoplasma malignum corporis
uteri
Innefattar:
Huden på de kvinnliga könsorganen
C54.0
Malign tumör i isthmus uteri
C51
Malign tumör i vulva
C54.1
Malign tumör i endometrium
Neoplasma malignum vulvae
C54.2
Malign tumör i myometrium
C51.0
Malign tumör i labium majus
C54.3
Malign tumör i fundus uteri
C51.1
Malign tumör i labium minus
C54.8
Malign tumör i corpus uteri med
övergripande växt
C51.2
Malign tumör i klitoris
C51.8
Malign tumör i vulva med
övergripande växt
Bartholins körtel
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C51.9
Ospecificerad lokalisation av malign
tumör i vulva
C54.9
Ospecificerad lokalisation av malign
tumör i corpus uteri
C55
Malign tumör i livmodern med
ospecificerad lokalisation
Neoplasma malignum uteri loco
non specificato
Pudendum
Yttre kvinnliga genitalia UNS
C52
Innefattar:
Livmodercancer UNS
Malign tumör i livmodern vars ursprung
ej kan hänföras till någon av kategorierna
C53-C54
Malign tumör i vagina
Neoplasma malignum vaginae
C53
Malign tumör i livmoderhalsen
Neoplasma malignum cervicis
uteri
C53.0
Malign tumör i endocervix
C53.1
Malign tumör i exocervix
C53.8
Malign tumör i cervix uteri med
övergripande växt
C56
Malign tumör i äggstock
Neoplasma malignum ovarii
C57
Malign tumör i andra och
ospecificerade kvinnliga
könsorgan
Neoplasma malignum aliorum
organorum genitalium
femininorum et non
specificatorum
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C53.9
Nedre uterinsegmentet
Ospecificerad lokalisation av malign
tumör i cervix uteri
93
C57.0
Malign tumör i äggledare
C57.1
Malign tumör i breda ligamentet
C57.2
Malign tumör i runda ligamentet
Tuba Fallopii
Tuba uterina
Ligamentum latum
C57.3
Malign tumör i parametrium
MALIGNA TUMÖRER I DE MANLIGA
KÖNSORGANEN (C60-C63)
C57.4
Malign tumör i uterina adnexa med
ospecificerad lokalisation
Neoplasmata maligna organorum
genitalium viri
C57.7
Malign tumör i andra specificerade
kvinnliga könsorgan
Uterinligament UNS
Innefattar:
Huden på de manliga könsorganen
Wollfska gången
C57.8
C60
Malign tumör i de kvinnliga
könsorganen med övergripande växt
Neoplasma malignum penis
Malign tumör i de kvinnliga
könsorganen vars ursprung ej kan
hänföras till någon av kategorierna C51C57.7, C58
C57.9
C60.0
Malign tumör i preputiet
C60.1
Malign tumör i glans penis
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C60.2
Malign tumör i peniskroppen
Ospecificerad lokalisation av malign
tumör i de kvinnliga könsorganen
C60.8
Malign tumör i penis med
övergripande växt
Kvinnliga urin- och könsorgan UNS
C58
Malign tumör i penis
Corpus cavernosum
Anmärkning:
Se anm 5 i inledningen till detta kapitel
Malign tumör i moderkakan
C60.9
Neoplasma malignum placentae
Koriokarcinom UNS
Korionepiteliom UNS
Ospecificerad lokalisation av malign
tumör i penis
Huden på penis UNS
Utesluter:
Chorioadenoma (destruens) (D39.2)
Hydatidiform mola:
• invasiv (D39.2)
• malign (D39.2)
• UNS (O01.9)
C61
Malign tumör i prostata
Neoplasma malignum prostatae
C62
Malign tumör i testikel
Neoplasma malignum testis
94
C62.0
Malign tumör i icke nedstigen testikel
C62.1
Malign tumör i nedstigen testikel
C62.9
Ospecificerad lokalisation av malign
tumör i testikel
C62.9A
Testikelcancer, seminom
C62.9B
Testikelcancer, annan än seminom
C62.9X
Testikelcancer, ospecificerad typ
Ektopisk testikel (som lokalisation för
tumör)
Retinerad testikel (som lokalisation för
tumör)
Normalt belägen testikel
Testikel i skrotum
C63
Malign tumör i andra och
ospecificerade manliga
könsorgan
MALIGNA TUMÖRER I URINORGANEN
(C64-C68)
Neoplasmata maligna organorum
urinariorum
Neoplasma malignum aliorum
organorum genitalium
masculinorum et non
specificatorum
C64
Malign tumör i njure med
undantag för njurbäcken
C63.0
Malign tumör i epididymis
Neoplasma malignum renis, pelvi
renali excepta
C63.1
Malign tumör i sädesledare
Utesluter:
Njurbäcken (C65)
Njurkalyces (C65)
C63.2
Malign tumör i skrotum
C63.7
Malign tumör i andra specificerade
manliga könsorgan
Bitestikel
Vas deferens
C65
Huden på skrotum
Neoplasma malignum pelvis
renalis
Njurkalyces
Pelviuretärövergången
Sädesblåsa
Tunica vaginalis
Vesicula seminales
C63.8
C66
Malign tumör i de manliga
könsorganen med övergripande växt
Malign tumör i de manliga könsorganen,
vars ursprung ej kan hänföras till någon
av kategorierna C60-C63.7
Utesluter:
Pelviuretärövergången (C65)
Uretärostiet (C67.6)
C67
Ospecificerad lokalisation av malign
tumör i de manliga könsorganen
Malign tumör i uretär
(urinledare)
Neoplasma malignum ureteris
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C63.9
Malign tumör i njurbäcken
Malign tumör i urinblåsan
Neoplasma malignum vesicae
urinariae
Manliga urin- och könsorgan UNS
95
C67.0
Malign tumör i trigonum
C67.1
Malign tumör i blåstaket
C67.2
Malign tumör i urinblåsans sidovägg
C67.3
Malign tumör i urinblåsans framvägg
C67.4
Malign tumör i urinblåsans bakvägg
C67.5
Malign tumör i blåshalsen
C67.6
Malign tumör i uretärostiet
C67.7
Malign tumör i urachusgången
Inre uretramynningen
Uretärinmynningen i blåsan
C67.8
MALIGNA TUMÖRER I ÖGA, HJÄRNAN
OCH ANDRA DELAR AV CENTRALA
NERVSYSTEMET (C69-C72)
Malign tumör i urinblåsan med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C67.9
Ospecificerad lokalisation av malign
tumör i urinblåsan
C68
Malign tumör i andra och
ospecificerade urinorgan
Neoplasmata maligna oculi, cerebri et
aliarum partium systematis nervosi
centralis
C69
Neoplasma malignum oculi et
organorum adnexorum
Neoplasma malignum organorum
aliorum urinariorum et non
specificatorum
Utesluter:
Urin- och könsorgan UNS:
• kvinnliga (C57.9)
• manliga (C63.9)
C68.0
Malign tumör i uretra
Malign tumör i öga och
närliggande vävnader
Utesluter:
Bindväv och brosk i ögonlock (C49.0)
Synnerv (C72.3)
Ögonlockshuden (C43.1, C44.1)
C69.0
Malign tumör i konjunktiva
Utesluter:
Inre uretramynningen (C67.5)
C69.1
Malign tumör i kornea
C69.2
Malign tumör i retina
C68.1
Malign tumör i parauretral körtel
C69.3
Malign tumör i korioidea
C68.8
Malign tumör i urinorganen med
övergripande växt
C69.4
Malign tumör i ciliarkropp
C69.5
Malign tumör i tårkörtel och tårkanal
C69.6
Malign tumör i orbita
Malign tumör i urinorganen, vars
ursprung ej kan hänföras till någon av
kategorierna C64-C68.1
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C68.9
Ospecificerad lokalisation av malign
tumör i urinorganen
Urinorganen UNS
Ductus nasolacrimalis
Tårsäck
Bindväv i orbita
Perifera nerver i orbita
Retrobulbär vävnad
Retrookulär vävnad
Yttre ögonmuskler
Utesluter:
Orbitalben (C41.0)
C69.8
Malign tumör i öga och adnexa med
övergripande växt
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C69.9
Ospecificerad lokalisation av malign
tumör i öga
Ögonlob
96
C70
Malign tumör i centrala
nervsystemets hinnor
C72
Neoplasma malignum meningium
C70.0
Malign tumör i hjärnhinnor
C70.1
Malign tumör i ryggmärgshinnor
C70.9
Ospecificerad lokalisation av malign
tumör i centrala nervsystemets hinnor
C71
Malign tumör i hjärnan
Neoplasma malignum cerebri
Utesluter:
Kranialnerver (C72.2-C72.5)
Retrobulbär vävnad (C69.6)
C71.0
Malign tumör i storhjärnan utom
lober och ventriklar
Supratentoriell lokalisation UNS
C71.1
Malign tumör i frontallob
C71.2
Malign tumör i temporallob
C71.3
Malign tumör i parietallob
C71.4
Malign tumör i occipitallob
C71.5
Malign tumör i hjärnventrikel
Neoplasma malignum medullae
spinalis, nervorum cranialium et
aliarum partium systematis
nervosi centralis
Utesluter:
Centrala nervsystemets hinnor (C70.-)
Perifera nerver och autonoma
nervsystemet (C47.-)
C72.0
Malign tumör i ryggmärgen
C72.1
Malign tumör i cauda equina
C72.2
Malign tumör i nervus olphactorius
C72.3
Malign tumör i nervus opticus
C72.4
Malign tumör i nervus statoacusticus
C72.5
Malign tumör i andra och
ospecificerade kranialnerver
C72.8
Malign tumör i hjärnan och andra
delar av centrala nervsystemet med
övergripande växt
Malign tumör i lillhjärnan
C71.7
Malign tumör i hjärnstammen
C71.8
Malign tumör i hjärnan med
övergripande växt
Nervus vestibulocochlearis
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C72.9
Fjärde ventrikeln
Infratentoriell lokalisation UNS
Ospecificerad lokalisation av malign
tumör i centrala nervsystemet
Centrala nervsystemet UNS
Anmärkning:
Se anm 5 i inledningen till detta kapitel
C71.9
Bulbus olphactorius
Malign tumör i hjärnan och andra delar
av centrala nervsystemet vars ursprung ej
kan hänföras till någon av kategorierna
C70-C72.5
Utesluter:
Fjärde ventrikeln (C71.7)
C71.6
Malign tumör i ryggmärgen,
kranialnerver och andra delar
av centrala nervsystemet
Ospecificerad lokalisation av malign
tumör i hjärnan
97
MALIGNA TUMÖRER I TYREOIDEA OCH
ANDRA ENDOKRINA KÖRTLAR
(C73-C75)
C75.5
Malign tumör i aortic body
(aortanära körtel) och andra
paraganglier
Neoplasmata maligna glandulae
thyreoideae et glandularum
endocrinarum
C75.8
Malign tumör med multiglandulärt
engagemang och med ospecificerad
lokalisation
C73
Anmärkning:
Om lokalisationerna av multipla
engagemang är kända skall de
klassificeras var för sig
Malign tumör i tyreoidea
Neoplasma malignum glandulae
thyreoideae
C74
C75.9
Malign tumör i binjure
Neoplasma malignum glandulae
suprarenalis
C74.0
Malign tumör i binjurebarken
C74.1
Malign tumör i binjuremärgen
C74.9
Ospecificerad lokalisation av malign
tumör i binjure
C75
Malign tumör i andra endokrina
körtlar och därmed besläktade
vävnader
Neoplasma malignum aliarum
glandularum endocrinarum et
telarum cognatarum
Utesluter:
Binjure (C74.-)
Pankreas endokrina del (C25.4)
Ovarium (C56)
Testis (C62.-)
Tymus (C37)
Tyreoidea (C73)
C75.0
Malign tumör i paratyreoidea
C75.1
Malign tumör i hypofysen
C75.2
Malign tumör i ductus
craniopharyngealis
C75.3
Malign tumör i corpus pineale
C75.4
Malign tumör i glomus caroticum
Bisköldkörteln
Tallkottkörteln
98
Malign tumör i ospecificerad
endokrin körtel
MALIGNA TUMÖRER MED
OFULLSTÄNDIGT ANGIVNA,
SEKUNDÄRA OCH OSPECIFICERADE
LOKALISATIONER (C76-C80)
C77
Neoplasma malignum
secundarium lymphonodorum et
non specificatum
Neoplasmata maligna loco secundario
male et non definito
C76
Utesluter:
Malign tumör i lymfkörtlar specificerad
som primär (C81-C86, C96.-)
Malign tumör med annan och
ofullständigt angiven
lokalisation
Neoplasma malignum loco alio et
male definito
Utesluter:
Malign tumör:
• i kvinnliga urin- och könsorgan UNS
(C57.9)
• i lymfatisk, blodbildande eller
besläktad vävnad (C81-C96)
• i manliga urin- och könsorgan UNS
(C63.9)
• utan specificerad lokalisation (C80.-)
C76.0
Sekundär malign tumör
(metastas) och ospecificerad
malign tumör i lymfkörtlar
Malign tumör i huvudet, ansiktet och
halsen
Kind UNS
Näsan UNS
C77.0
Sekundär malign tumör (metastas) i
lymfkörtlar i huvudet, ansiktet och
halsen
Supraklavikulära lymfkörtlar
C77.1
Sekundär malign tumör (metastas) i
intratorakala lymfkörtlar
C77.2
Sekundär malign tumör (metastas) i
intraabdominella lymfkörtlar
C77.3
Sekundär malign tumör (metastas) i
lymfkörtlar i axill och övre extremitet
Pektorala lymfkörtlar
C77.4
Sekundär malign tumör (metastas) i
lymfkörtlar i ljumske och nedre
extremitet
C76.1
Malign tumör i bröstkorgen
Axill UNS
Intratorakalt UNS
C77.5
Sekundär malign tumör (metastas) i
lymfkörtlar i bäckenet
C76.2
Malign tumör i buken
C77.8
C76.3
Malign tumör i bäckenet
Sekundär malign tumör (metastas) i
lymfkörtlar i multipla kroppsregioner
C77.9
Ospecificerad lokalisation av
sekundär malign tumör (metastas) i
lymfkörtlar
C76.4
Malign tumör i övre extremitet
C78
C76.5
Malign tumör i nedre extremitet
Sekundär malign tumör
(metastas) i andningsorganen
och matsmältningsorganen
C76.7
Malign tumör i andra ofullständigt
angivna lokalisationer
C76.8
Malign tumör med annan och
ofullständigt angiven lokalisation och
med övergripande växt
C78.0
Sekundär malign tumör (metastas) i
lunga
Anmärkning:
(Se anm 5 i inledningen till detta kapitel)
C78.1
Sekundär malign tumör (metastas) i
mediastinum
Ljumske UNS
Övergripande växt i bäckenet såsom:
• rektovaginalt (septum)
• rektovesikalt (septum)
99
Neoplasma malignum
secundarium organorum
respiratoriorum et digestoriorum
C78.2
Sekundär malign tumör (metastas) i
lungsäck
C79.6
Sekundär malign tumör (metastas) i
ovarium
C78.3
Sekundär malign tumör (metastas) i
andra och ospecificerade
andningsorgan
C79.7
Sekundär malign tumör (metastas) i
binjure
C79.8
Sekundär malign tumör (metastas) i
andra specificerade lokalisationer
C79.9
Sekundär malign tumör (metastas),
ospecificerad lokalisation
C78.4
Sekundär malign tumör (metastas) i
tunntarmen inklusive duodenum
C78.5
Sekundär malign tumör (metastas) i
tjocktarmen och rektum
C78.6
Sekundär malign tumör (metastas) i
retroperitonealrummet och
peritoneum
Disseminerad (sekundär):
• cancer UNS
• malignitet UNS
Generaliserad (sekundär):
• cancer UNS
• malignitet UNS
Karcinomatos (sekundär)
Multipel sekundär cancer UNS
Sarkomatos (sekundär) UNS (C80.-)
Malign ascites UNS
C78.7
C78.8
C79
Sekundär malign tumör (metastas) i
levern och intrahepatiska
gallgångarna
C80
Sekundär malign tumör (metastas) i
andra och ospecificerade
matsmältningsorgan
Neoplasma malignum loco non
specificato
Sekundär malign tumör
(metastas) med andra och
ospecificerade lokalisationer
C80.0
Neoplasma malignum
secundarium (metastasis) aliis
locis non specificatis
C80.9
C79.0
Sekundär malign tumör (metastas) i
njure och njurbäcken
C79.1
Sekundär malign tumör (metastas) i
urinblåsa och andra och
ospecificerade urinorgan
C79.2
Sekundär malign tumör (metastas) i
huden
C79.3
Sekundär malign tumör (metastas) i
hjärnan och hjärnhinnorna
C79.4
Sekundär malign tumör (metastas) i
andra och ospecificerade delar av
nervsystemet
C79.5
Sekundär malign tumör (metastas) i
ben och benmärg
Malign tumör utan specificerad
lokalisation
Malign tumör, primär lokalisation
angiven som okänd
Primär lokal okänd
Malign tumör, ospecificerad primär
lokalisation
Cancer UNS
Karcinom UNS
Malign kakexi UNS
Malignitet UNS
Multipel cancer UNS
Utesluter:
Multipel sekundär cancer UNS (C79.9)
Sekundär malign tumör, ospecificerad
lokalisation (C79.9)
100
MALIGNA TUMÖRER I LYMFATISK,
BLODBILDANDE OCH BESLÄKTAD
VÄVNAD (C81-C96)
Neoplasmata maligna telae
lymphaticae, haematopoieticae et telae
cognatae
Utesluter:
Sekundär malign tumör (metastas) och ospecificerad
malign tumör i lymfkörtlar (C77.-)
C81
Hodgkins lymfom
Lymphoma Hodgkin
C81.0
Nodulärt lymfocytdominerat
Hodgkins lymfom
C81.1
Hodgkins lymfom (klassiskt) med
nodulär skleros
C81.2
Hodgkins lymfom (klassiskt) med
blandad cellularitet
C81.3
Lymfocytfattigt (klassiskt) Hodgkins
lymfom
C81.4
Lymfocytrikt (klassiskt) Hodgkins
lymfom
C82.2
Follikulärt lymfom, ospecificerad
grad III
C82.3
Follikulärt lymfom grad IIIa
C82.4
Follikulärt lymfom grad IIIb
C82.5
Diffust follikelcenterlymfom
C82.6
Kutant follikelcenterlymfom
C82.7
Andra specificerade typer av
follikulärt lymfom
C82.9
Follikulärt lymfom, ospecificerat
C83
Icke-follikulärt lymfom
Lymphoma non folliculare
C83.0
Annan typ form av (klassiskt)
Hodgkins lymfom
Hodgkins lymfom (klassiskt), ej
specificerad typ
C81.9
Hodgkins lymfom, ospecificerat
C82
Follikulärt lymfom
Lymphoma folliculare
Innefattar:
Follikulärt lymfom med eller utan
diffusa områden
Utesluter:
T-cellslymfom (C84.-)
C82.0
Follikulärt lymfom grad I
C82.1
Follikulärt lymfom grad II
101
Småcelligt B-cellslymfom
Diffust småcelligt B-cellslymfom
Icke-leukemisk variant av B-KLL
Lymfoplasmocytiskt lymfom
Nodalt marginalzonslymfom
Icke-leukemisk variant av B-KLL
Spleniskt marginalzonslymfom
Utesluter;
Kronisk lymfatisk leukemi (C91.1)
Mogna T/NK-cellslymfom (C84.-)
Waldenströms makroglobulinemi
(C88.0)
Utesluter:
Nodulärt lymfocytdominerat Hodgkins
lymfom (C81.0)
C81.7
Nodulärt lymfom UNS
C83.0A
Diffust småcelligt B-cellslymfom (icke
leukemisk variant av B-KLL)
C83.0B
Lymfoplasmocytiskt lymfom
(immunocytom)
C83.0C
Nodalt marginalzonslymfom
C83.0D
Marginalzonslymfom i mjälten
C83.1
Mantelcellslymfom
Centrocytiskt lymfom
C83.3
C84
Diffust storcelligt B-cellslymfom
Diffust storcelligt B-cellslymfom:
• anaplastiskt
• CD30-positivt
• centroblastiskt
• immunoblastiskt
• ospecificerad subtyp
• plasmoblastiskt
• T-cellsrikt
Lymphomata T/NK-cellularia
matura
Utesluter:
Mediastinalt (tymiskt) storcelligt Bcellslymfom (C85.2)
Mogna T/NK-cellslymfom (C84.-)
C83.5
Mycosis fungoides
C84.1
Sézarys syndrom
C84.4
Perifert T-cellslymfom, ej klassificerat
C84.5
Andra mogna T/NK-cellslymfom
B-prekursorlymfom
Lymfoblastiskt B-cellslymfom
Lymfoblastiskt lymfom UNS
Lymfoblastiskt T-cellslymfom
T-prekursorlymfom
Lymfoblastiskt lymfom, T-cells och Tprekursor
C83.5B
Lymfoblastiskt lymfom, B-cells och Bprekursor
C83.5X
Lymfoblastiskt lymfom, ospecificerat
C83.7
Burkitts lymfom
Lennerts lymfom
Lymfoepitelioid-lymfom
Anmärkning:
Om T-cellsursprung eller Tcellsengagemang nämns i samband med
en specificerad lymfomtyp klassificeras
fallet enligt den mer specifika
beskrivningen
Utesluter:
Angioimmunoblastiskt T-cellslymfom
(C86.5)
Blastiskt NK-cellslymfom (C86.4)
Enteropatiskt T-cellslymfom (C86.2)
Extranodalt NK-cellslymfom, nasal typ
(C86.0)
Hepatospleniskt T-cellslymfom (C86.1)
Primärt kutana CD30-positiva Tcellsproliferationer (C86.6)
Subcutant pannikulitliknande Tcellslymfom (C86.3)
T-cellsleukemi (C91.-)
Atypiskt Burkitts lymfom
”Burkitt-liknande” lymfom
Utesluter:
Mogen B-cellsleukemi av Burkitt-typ
(C91.8)
C84.6
Anaplastiskt storcelligt lymfom, ALKpositivt
Anaplastiskt storcelligt lymfom, CD30positivt
Andra icke-follikulära lymfom
Primärt effusionslymfom (av B-cellstyp)
Intravaskulärt storcelligt B-cellslymfom
Lymfoid granulomatos
Utesluter:
Mediastinalt (tymiskt) storcelligt Bcellslymfom (C85.2)
T-cellsrikt B-cellslymfom
C83.9
C84.0
Lymfoblastiskt lymfom
C83.5A
C83.8
Mogna T/NK-cellslymfom
C84.7
Anaplastiskt storcelligt lymfom, ALKnegativt
Utesluter:
Primärt kutana CD30-positiva Tcellsproliferationer (C86.6)
Icke-follikulärt (diffust) lymfom,
ospecificerat
C84.8
Kutant T-cellslymfom, ospecificerat
C84.9
Moget T/NK-cellslymfom,
ospecificerat
NK/T-cells lymfom UNS
Utesluter:
Moget T-cellslymfom som ej
klassificeras på annan plats (C84.4)
102
C85
C85.1
Andra och ospecificerade typer
av non-Hodgkin-lymfom
C86.3
Subkutant pannikulitliknande Tcellslymfom
Aliae species non specificatae
lymphomatis non-Hodgkin
C86.4
Blastiskt NK-cellslymfom
C86.5
Angioimmunoblastiskt T-cellslymfom
C86.6
Primärt kutana CD30-positiva Tcellsproliferationer
B-cellslymfom, ospecificerat
Anmärkning:
Om B-cellsursprung eller Bcellsengagemang nämns i samband med
en specificerad lymfomtyp klassificeras
fallet enligt den mer specifika
beskrivningen.
C85.1A
B-cellslymfom, lågmalignt, ospecificerat
C85.1B
B-cellslymfom, högmalignt,
ospecificerat
C85.2
Mediastinalt (tymiskt) storcelligt Bcellslymfom
C85.7
Andra specificerade typer av nonHodgkin-lymfom
C85.9
Non-Hodgkin-lymfom, ospecificerad
typ
Lymfomatoid papulos
Primärt kutant anaplastiskt storcelligt
lymfom
Primärt kutant CD30-positivt storcelligt
T-cellslymfom
C88
Non-Hodgkin-lymfom, lågmalignt,
ospecificerat
C85.9B
Non-Hodgkin-lymfom, högmalignt,
ospecificerat
C86
Andra specificerade typer av
T/NK-cellslymfom
Maligna immunoproliferativa
sjukdomar
Alia lymphomata B-cellularia
[morbi immunoproliferativi
maligni]
C88.0
Lymfom UNS
Malignt lymfom UNS
Non-Hodgkin-lymfom UNS
C85.9A
Angioimmunoblastisk lymfadenopati
med dysproteinemi [AILD]
Waldenströms makroglobulinemi
Lymfoplasmocytiskt lymfom med IgMproduktion
Makroglobulinemi (primär)(idiopatisk)
Utesluter:
Småcelligt B-cellslymfom (C83.0)
Aliae species specificatae T/NKlymphomatum cellularium
Utesluter:
Anaplastiskt storcelligt lymfom, ALKnegativt (C84.7)
Anaplastiskt storcelligt lymfom, ALKpositivt (C84.6)
C86.0
Extranodalt NK/T-cellslymfom, nasal
typ
C86.1
Hepatospleniskt T-cellslymfom
C86.2
Enteropatiskt (intestinalt) Tcellslymfom
Alfa-beta och gamma-delta typer
Enteropatiassocierat T-cellslymfom
103
C88.2
Annan ” heavy chain disease”
C88.3
Immunoproliferativ
tunntarmssjukdom
Franklins sjukdom
Gamma heavy chain disease
Mμ heavy chain disease
Medelhavslymfom
Alpha heavy chain disease
C88.4
Extranodalt marginalzons-Bcellslymfom av mukosaassocierad
lymfoid vävnad [MALT-lymfom]
Anmärkning:
Tilläggskod (C83.3) kan användas för att
ange övergång till högmalignt (diffust
storcelligt) lymfom
Lymfom i hudassocierad lymfoid
vävnad (SALT-lymfom)
Lymfom i bronkassocierad lymfoid
vävnad (BALT-lymfom)
C88.7
Andra specificerade maligna
immunoproliferativa sjukdomar
C88.7A
POEMS syndrom
C88.7W
Annan specificerad malign
immunoproliferativ sjukdom
C88.9
Malign immunoproliferativ sjukdom,
ospecificerad
C91.1
Lymfoplasmocytleukemi
Richters syndrom
Utesluter:
Lymfoplasmocytiskt lymfom (C83.0)
Immunoproliferativ sjukdom UNS
C90
Myelom och maligna
plasmacellstumörer
C91.3
Prolymfocytleukemi av B-cellstyp
C91.4
Hårcellsleukemi
C91.5
Adult T-cellslymfom/leukemi (HTLV1-associerad)
Multipelt myelom
Kahlers sjukdom
Medullärt plasmocytom
Myelom
Myelomatos
Plasmacellsmyelom
Utesluter:
Solitärt plasmocytom (C90.3)
C90.1
Plasmacellsleukemi
C90.2
Extramedullärt plasmocytom
C90.3
Solitärt plasmocytom
C91
C91.6
Prolymfocytleukemi av T-cellstyp
C91.7
Annan lymfatisk leukemi
C91.8
Mogen B-cellsleukemi av Burkitt-typ
Storgranulär T-cellslymfocytleukemi
(associerad med reumatoid artrit)
Utesluter:
Burkitt-lymfom med liten eller ingen
benmärgsinfiltration (C83.7)
Plasmocytär leukemi
Lokaliserad malign plasmacellstumör
UNS
Plasmocytom UNS
Solitärt myelom
C91.9
Lymfatisk leukemi UNS
C92
Myeloisk leukemi
Leuchaemia myeloica
Innefattar:
Granulocytleukemi
Myelogen leukemi
Lymfatisk leukemi
Leuchaemia lymphatica
C91.0
Leukemisk retikuloendotelios
Variant:
• Akut
• Kronisk
• Lymfomatoid
• Smouldering (pyrande)
Myeloma et neoplasmata
plasmacellularia maligna
C90.0
Kronisk lymfatisk leukemi av Bcellstyp [B-KLL]
C92.0
Akut lymfatisk leukemi [ALL]
Anmärkning:
Denna kod skall endast användas för Tcellsleukemi (T-ALL) och prekursor-Bcellsleukemi (pre-B-ALL)
C91.0A
Akut lymfatisk leukemi (T-ALL)
C91.0B
Akut lymfatisk leukemi (pre-B-ALL, BALL)
Akut myeloisk leukemi [AML]
Akut myeloblastleukemi, minimal
differentiering
Akut myeloblastleukemi (med
utmognad)
AML1/ETO
AML M0
AML M1
AML M2
AML med t(8;21)
AML (utan FAB klassificering) UNS
Refraktär anemi med överskott av blaster
i transformation
Utesluter:
Akut exacerbation av kronisk myeloisk
leukemic (C92.1)
104
C92.0A
Akut myeloisk leukemi (M0, M1, M2)
C92.0B
Akut myeloisk leukemi (t8;21)
C92.1
Kronisk myeloisk leukemi [KML],
BCR/ABL-positiv
C93
Monocytleukemi
Leuchaemia monocytica
Innefattar:
Monocytoid leukemi
Kronisk myeloisk leukemi:
• med blastkris
• Philadelphia-kromosom (Ph1) positiv
• t(9;22)(q34;q11)
Utesluter:
Atypisk kronisk myeloisk leukemi
BCR/ABL-negativ (C92.2)
Icke-klassificerad myeloproliferativ
sjukdom (D47.1)
Kronisk myelomonocytleukemi (C93.1)
C93.0
Akut monoblast-/monocytleukemi
C93.1
Kronisk myelomonocytleukemi
[KMML]
AML M5a
AML M5b
AML M5
Kronisk monocytleukemi
KMML-1
KMML-2
KMML med eosinofili
C92.2
Atypisk kronisk myeloisk leukemi,
BCR/ABL-negativ
C93.3
Juvenil myelomonocytleukemi
C92.3
Myelosarkom
C93.7
Annan specificerad monocytleukemi
Anmärkning:
En tumör av omogna myeloida celler
C93.9
Monocytleukemi, ospecificerad
C94
Andra leukemier med
specificerad celltyp
Granulocytärt sarkom
Klorom
C92.4
Akut promyelocytleukemi [PML]
AML M3
AML Me med t(15;17) och varianter
C92.5
Akut myelomonocytleukemi
C92.6
Akut myeloisk leukemi med 11q23abnormitet
Aliae leuchaemiae specie
cellularum indicata
Utesluter:
Leukemisk retikuloendotelios (C91.4)
Plasmacellsleukemi (C90.1)
AML M4
AML M4 Eo med inv(16) eller t(16;16)
C94.0
Akut erytroid leukemi
C94.2
Akut megakaryoblastleukemi (FAB
M7)
Akut myeloisk leukemi med MLLgenvariation
C92.7
Annan specificerad myeloisk leukemi
Akut myeloisk leukemi med dysplasi
med multilinjärt ursprung
Anmärkning:
Akut myeloisk leukemi med dysplasi av
kvarvarande hematopoes och/eller
tidigare myelodysplastisk sjukdom
C92.9
Akut myeloisk leukemi, M6 (a)(b)
Erytroleukemi
Akut megakaryocytleukemi
Akut myeloisk leukemi, M7
Utesluter:
Kronisk eosinofil leukemi
[hypereosinofilt syndrom] (D47.5)
C92.8
Monocytleukemi UNS
Myeloisk leukemi, ospecificerad
Myeloisk leukemi UNS
105
C94.3
Mastcellsleukemi
C94.4
Akut panmyelos med myelofibros
C94.6
Myelodysplastisk och
myeloproliferativ sjukdom, ej
klassificerad
C94.7
Andra specificerade leukemier
Akut myelofibros
Aggressiv NK-cellsleukemi
Akut basofil leukemi
C95
Leukemi med ospecificerad
celltyp
C96.5
Hand-Schüller-Christians sjukdom
Histiocytos X, multifokal
Leuchaemia, specie cellularum
non indicata
C95.0
Multifokal och unisystemisk
Langerhanscellshistiocytos
Akut leukemi med ospecifierad celltyp
Akut leukemi med bilinjärt ursprung
Akut leukemi med blandat ursprung
Bifenotypisk akut leukemi
Stamcellsleukemi med oklart ursprung
Utesluter:
Akut exacerbation av ospecificerad
kronisk leukemi (C95.1)
C96.6
Unifokal Langerhanscellshistiocytos
C96.7
Andra specificerade primära maligna
tumörer i lymfoid, blodbildande och
besläktad vävnad
Eosinofilt granulom
Histiocytos X, unifokal
Histiocytos X UNS
Langerhanscellshistiocytos UNS
C95.1
Kronisk leukemi med ospecificerad
celltyp
C96.8
Histiocytärt sarkom
C95.7
Annan leukemi med ospecificerad
celltyp
C96.9
Primär, malign tumör i lymfoid,
blodbildande och besläktad vävnad,
ospecificerad
C95.9
Leukemi, ospecificerad
C96
Övriga och ospecificerade
maligna tumörer i lymfoid,
blodbildande och besläktad
vävnad
Leukemi UNS
Alia neoplasmata maligna non
specificata telae lymphoidis, telae
haematopoieticae et telae
cognatae
C96.0
Multifokal och multisystemisk
(disseminerad)
Langerhanscellshistiocytos [LettererSiwes sjukdom]
Histiocytos X, multisystemisk
C96.2
Malign mastcellstumör
Aggressiv systemisk mastocytos
Mastcellssarkom
Utesluter:
Indolent systemisk mastocytos (D47.0)
Mastcellsleukemi (C94.3)
Mastocytos (kongenital) (kutan) (Q82.2)
C96.4
Sarkom från dendritiska
(accessoriska) celler
Interdigiterande dendritcellssarkom
Langerhanscellssarkom
Sarkom från follikulära dendritiska
celler
106
Malign histiocytos
FLERA (PRIMÄRA) MALIGNA
TUMÖRER MED OLIKA URSPRUNG
(C97)
CANCER IN SITU (LOKALT
BEGRÄNSAD CANCER UTGÅNGEN
FRÅN EPITEL) (D00-D09)
Neoplasmata maligna loco primario
multiplici
Carcinoma in situ
C97
Anmärkning:
Många in situ-tumörer uppfattas befinna sig inom ett
kontinuum av morfologisk förändring mellan
dysplasi och invasiv cancer. Så har man t ex för
cervikal intraepitelial neoplasi (CIN) definierat tre
grader. Den tredje av dessa (CIN III) omfattar både
svår dysplasi och cancer in situ. Detta
indelningssystem har också utvidgats till att gälla
andra organ såsom vulva och vagina. Förändringar
som beskrivs som intraepitelial neoplasi av grad III
hänförs till cancer in situ-avsnittet oavsett om svår
dysplasi nämns eller ej. Grad I och II klassificeras
som dysplasi i det berörda organet och kodas under
respektive organsystemkapitel.
Flera (primära) maligna
tumörer med olika ursprung
Neoplasmata maligna locis
multiplicibus independentibus
(primariis)
Anmärkning:
I första hand klassificeras de olika
tumörerna var för sig på tillämpliga
kodnummer. Koden C97 kan då
användas som tilläggskod för att ange
förekomsten av flera samtidiga, olika
tumörer.
Innefattar:
Bowens sjukdom
Erytroplasi
Morfologikoder med malignitetskod /2
Queyrats erytroplasi
D00
Cancer in situ i munhåla,
esofagus och magsäck
Carcinoma in situ cavi oris,
oesophagi et ventriculi
Utesluter:
Melanom in situ (D03.-)
D00.0
Cancer in situ i läpp, munhåla och
svalg
Aryepiglottiska vecket:
• hypofaryngeala delen
• marginala zonen
• UNS
På läpprödsgränsen
Utesluter:
Aryepiglottiska vecket, laryngeala delen
(D02.0)
Epiglottis:
• suprahyoidala delen (D02.0)
• UNS (D02.0)
Läpphuden (D03.0, D04.0)
107
D00.1
Cancer in situ i esofagus
D00.2
Cancer in situ i magsäcken
D01
Cancer in situ i andra och
ospecificerade delar av
matsmältningsorganen
D02.0
Utesluter:
Melanoma in situ (D03.-)
Cancer in situ i tjocktarmen
Utesluter:
Rektosigmoidala gränszonen (D01.1)
D01.1
Cancer in situ i rektosigmoidala
gränszonen
D01.2
Cancer in situ i rektum
D01.3
Cancer in situ i anus och analkanalen
D02.1
Cancer in situ i trakea
D02.2
Cancer in situ i bronk och lunga
D02.3
Cancer in situ i andra delar av
andningsorganen
Mellanöra
Näsans bihålor
Näshåla
Utesluter:
Anala gränszonen (D03.5, D04.5)
Analhuden (D03.5, D04.5)
Perianala huden (D03.5, D04.5)
D01.4
Cancer in situ i andra och
ospecificerade delar av tarmen
Utesluter:
Näsan UNS (D09.7)
Näshuden (D03.3, D04.3)
Öra (ytteröra) (huden) (D03.2, D04.2)
D02.4
Ospecificerad lokalisation av cancer
in situ i andningsorganen
D03
Melanom in situ
Melanoma in situ
Utesluter:
Ampulla Vateri (D01.5)
D01.5
Innefattar:
Morfologikoderna M872-M879 med
malignitetskod /2
Cancer in situ i lever, gallblåsa och
gallgångar
Ampulla Vateri
D01.7
Aryepiglottiska vecket, laryngeala delen
Epiglottis (suprahyoidala delen)
Utesluter:
Aryepiglottiska vecket:
• hypofaryngeala delen (D00.0)
• marginala zonen (D00.0)
• UNS (D00.0)
Carcinoma in situ aliorum
organorum digestionis et non
specificatorum
D01.0
Cancer in situ i larynx
Cancer in situ i andra specificerade
matsmältningsorgan
D03.0
Melanom in situ på läpp
D03.1
Melanom in situ på ögonlock
inklusive ögonvrå
D03.2
Melanom in situ på öra och i yttre
hörselgång
D03.3
Melanom in situ i andra och
ospecificerade delar av ansiktet
D03.4
Melanom in situ i hårbotten och på
halsen
D03.5
Melanom in situ på bålen
D03.6
Melanom in situ på övre extremitet
inklusive skuldran
Pankreas
D01.9
Ospecificerad lokalisation av cancer
in situ i matsmältningsorgan
D02
Cancer in situ i mellanöra och
andningsorgan
Carcinoma in situ auris mediae et
systematis respiratorii
Utesluter:
Melanom in situ (D03.-)
108
Anala gränszonen
Analhuden
Bröstkörtel (huden) (mjukvävnad)
Perianala huden
D03.7
Melanom in situ på nedre extremitet
inklusive höften
D03.8
Melanom in situ med andra
lokalisationer
D03.9
Ospecificerad lokalisation av
melanom in situ
D04
Cancer in situ i huden
Utesluter:
Melanom in situ (D03.-)
Queyrats erytroplasi på penis UNS
(D07.4)
Cancer in situ i läpphuden
Utesluter:
Läpprödsgränsen (D00.0)
D04.1
Cancer in situ i huden på ögonlock
inklusive ögonvrå
D04.2
Cancer in situ i huden på öra och i
hörselgång
D04.3
Cancer in situ i huden i andra och
ospecificerade delar av ansiktet
D04.5
Cancer in situ i huden på bålen
Anala gränszonen
Analhuden
Huden över bröstkörtel
Perianala huden
Utesluter:
Anus UNS (D01.3)
Huden på könsorganen (D07.-)
D04.8
D04.9
D05.0
Lobulär cancer in situ
D05.1
Cancer in situ i körtelgångarna
D05.7
Annan cancer in situ i bröstkörtel
D05.9
Ospecificerad lokalisation av cancer
in situ i bröstkörtel
D06
Cancer in situ i livmoderhalsen
Carcinoma in situ cervicis uteri
Utesluter:
Melanom in situ i cervix (D03.8)
Svår dysplasi i cervix UNS (ej angiven
som CIN III) (N87.2)
Cancer in situ i hårbotten och huden
på halsen
D04.7
Carcinoma in situ mammae
Innefattar:
Cervikal intraepitelial neoplasi [CIN],
grad III, med eller utan att svår dysplasi
nämns
D04.4
D04.6
Cancer in situ i bröstkörtel
Utesluter:
Cancer in situ i huden över bröstkörtel
(D04.5)
Melanom in situ i huden över bröstkörtel
(D03.5)
Carcinoma in situ cutis
D04.0
D05
D06.0
Cancer in situ i endocervix
D06.1
Cancer in situ i exocervix
D06.7
Cancer in situ i andra delar av cervix
D06.9
Ospecificerad lokalisation av cancer
in situ i cervix
D07
Cancer in situ i andra och
ospecificerade könsorgan
Carcinoma in situ aliorum
organorum genitalium et non
specificatorum
Cancer in situ i huden på övre
extremitet inklusive skuldran
Utesluter:
Melanom in situ (D03.8)
Cancer in situ i huden på nedre
extremitet inklusive höften
Cancer in situ i huden med andra
lokalisationer
Ospecificerad lokalisation av cancer
in situ i huden
D07.0
Cancer in situ i endometrium
D07.1
Cancer in situ i vulva
Intraepitelial neoplasi i vulva [VIN],
grad III, med eller utan att svår dysplasi
nämns
Utesluter:
Svår dysplasi i vulva UNS (ej angiven
som VIN III) (N90.2)
109
D07.2
Cancer in situ i vagina
Vaginal intraepitelial neoplasi [VAIN],
grad III, med eller utan att svår dysplasi
nämns
Utesluter:
Svår dysplasi i vagina UNS (ej angiven
som VAIN III) (N89.2)
D07.3
Cancer in situ i andra och
ospecificerade kvinnliga könsorgan
D07.4
Cancer in situ i penis
D07.5
Cancer in situ i prostata
BENIGNA TUMÖRER (D10-D36)
Neoplasmata benigna
Innefattar:
Morfologikoder med malignitetskod /0
D10
Neoplasma benignum oris et
pharyngis
Queyrats erytroplasi
D10.0
Utesluter:
Låggradig dysplasi i prostata (N42.3)
D07.6
D09
Benign tumör i läpp
Frenulum labii
Läpp (insida) (slemhinnan) (på
läpprödsgränsen)
Utesluter:
Läpphuden (D22.0, D23.0)
Cancer in situ i andra och
ospecificerade manliga könsorgan
D10.1
Benign tumör i tungan
Cancer in situ med annan och
ospecificerad lokalisation
D10.2
Benign tumör i munbotten
D10.3
Benign tumör i andra och
ospecificerade delar av munhålan
Carcinoma in situ loco alio et non
specificato
D09.0
Cancer in situ i urinblåsan
D09.1
Cancer in situ i andra och
ospecificerade urinorgan
D09.2
Cancer in situ i öga
Utesluter:
Benigna odontogena tumörer (D16.4D16.5)
Läppslemhinnan (D10.0)
Rinofaryngeala ytan av mjuka gommen
(D10.6)
D10.4
Cancer in situ i tyreoidea och andra
endokrina körtlar
D10.5
Utesluter:
Endokrina delen av pankreas (D01.7)
Ovarium (D07.3)
Pankreas endokrina del
Testis (D07.6)
Cancer in situ med andra
specificerade lokalisationer
D09.9
Ospecificerad lokalisation av cancer
in situ
Benign tumör i tonsill
Utesluter:
Svalgtonsill (D10.6)
Tonsillgropen (D10.5)
Tonsillvecken (D10.5)
Tungtonsill (D10.1)
Utesluter:
Ögonlockshuden (D04.1)
D09.7
Tungtonsillen
Små spottkörtlarna UNS
Utesluter:
Melanom in situ (D03.-)
D09.3
Benign tumör i munhåla och
svalg
Benign tumör i andra delar av
orofarynx
Epiglottis, främre ytan
Tonsillgropen
Tonsillvecken
Vallecula
Utesluter:
Epiglottis UNS (D14.1)
Suprahyoidala delen av epiglottis
(D14.1)
D10.6
110
Benign tumör i rinofarynx
Bakre kanten av nässeptum och bakre
näsöppningen
Svalgtonsill
D10.7
Benign tumör i hypofarynx
D12.7
D10.9
Ospecificerad lokalisation av benign
tumör i svalget
Benign tumör i rektosigmoidala
gränszonen
D12.8
Benign tumör i rektum
D11
Benign tumör i de stora
spottkörtlarna
D12.9
Benign tumör i anus och analkanal
Utesluter:
Anala gränszonen (D22.5, D23.5)
Analhuden (D22.5, D23.5)
Perianala huden (D22.5, D23.5)
Neoplasma benignum
glandularum salivarium majorum
Utesluter:
Benigna tumörer i specificerade små
spottkörtlar,
som klassificeras med hänsyn till deras
anatomiska lokalisation
Benigna tumörer i de små spottkörtlarna
UNS (D10.3)
D11.0
Benign tumör i parotiskörteln
D11.7
Benign tumör i andra stora
spottkörtlar
Sublingualiskörteln
Submandibulariskörteln
D13
Benign tumör i andra och
ofullständigt angivna delar av
matsmältningsorganen
Neoplasma benignum aliarum et
male definitarum partium
organorum digestoriorum
D13.0
Benign tumör i esofagus
D13.1
Benign tumör i magsäck
D13.2
Benign tumör i duodenum
D13.3
Benign tumör i andra och
ospecificerade delar av tunntarmen
D11.9
Benign tumör i stor spottkörtel,
ospecificerad
D12
Benign tumör i tjocktarm,
ändtarm, anus och analkanal
D13.4
Benign tumör i levern
Neoplasma benignum coli, recti,
ani et canalis ani
D13.5
Benign tumör i extrahepatiska
gallgångarna
Benign tumör i caecum
D13.6
Benign tumör i pankreas
D12.0
Iliocaecalvalveln
D12.1
Benign tumör i appendix
D12.2
Benign tumör i colon ascendens
D12.3
Benign tumör i colon transversum
Utesluter:
Pankreas endokrina del (D13.7)
D13.7
Benign tumör i colon descendens
D12.5
Benign tumör i sigmoideum
D12.6
Ospecificerad lokalisation av benign
tumör i kolon
Benign tumör i pankreas endokrina
del
Tumör i Langerhanska öarna
Flexura hepatica
Flexura lienalis
D12.4
Intrahepatiska gallgångarna
D13.9
Ofullständigt angivna lokalisationer
av benign tumör i
matsmältningsorganen
Matsmältningsorganen UNS
Mjälten
Tunntarmen UNS
Adenomatos i kolon
Polypos (hereditär) i kolon
Tjocktarmen UNS
111
D14
Benign tumör i mellanöra och
andningsorgan
Neoplasma benignum auris
mediae et systematis respiratorii
D14.0
Benign tumör i mellanöra, näshåla
och bihålor
Näsbrosken
Utesluter:
Bakre kanten av nässeptum och bakre
näsöppningen (D10.6)
Bulbus olfactorius (D33.3)
Hörselgång (yttre) (D22.2, D23.2)
Näsa UNS (D36.7)
Näsben (D16.4)
Näshuden (D22.3, D23.3)
Polyp i:
• bihålor (J33.8)
• mellanöra (H74.4)
• näsa (näshåla) (J33.-)
Öra (ytteröra) (huden) (D22.2, D23.2)
Öronben (D16.4)
Öronbrosk (D21.0)
D14.1
D15.0
Benign tumör i tymus
D15.1
Benign tumör i hjärtat
Utesluter:
De stora kärlen (D21.3)
D15.2
Benign tumör i mediastinum
D15.7
Benign tumör i andra specificerade
intratorakala organ
D15.9
Specificerad lokalisation av benign
tumör i intratorakala organ
D16
Benign tumör i ben och
ledbrosk
Neoplasma benignum ossis et
cartilaginis articularis
Utesluter:
Bindväv i:
• larynx (D14.1)
• näsan (D14.0)
• ögonlock (D21.0)
• öra (D21.0)
Synovialmembran (D21.-)
Benign tumör i larynx
Epiglottis (suprahyoidala delen)
Utesluter:
Epiglottis, främre delen (D10.5)
Polyp på stämband och i larynx (J38.1)
D16.0
Benign tumör i skulderbladet och
övre extremitetens långa ben
D14.1A
Larynxpapillom
D16.1
D14.1W
Annan specificerad benign tumör i
larynx
Benign tumör i övre extremitetens
korta ben
D16.2
Benign tumör i nedre extremitetens
långa ben
D16.3
Benign tumör i nedre extremitetens
korta ben
D16.4
Benign tumör i skallens och ansiktets
ben
D14.1X
Benign larynxtumör, ospecificerad
D14.2
Benign tumör i trakea
D14.3
Benign tumör i bronk och lunga
D14.4
Ospecificerad lokalisation av benign
tumör i andningsorgan
D15
Benign tumör i andra och
ospecificerade organ i
brösthålan
Överkäksben
Ögonhålans ben
Utesluter:
Underkäksben (D16.5)
Neoplasma benignum aliorum
organorum endothoracicorum et
non specificatorum
Utesluter:
Mesotelial vävnad (D19.-)
D16.5
Benign tumör i underkäksben
D16.6
Benign tumör i kotpelaren
Utesluter:
Sakrum och koccyx (D16.8)
D16.7
112
Benign tumör i revben, bröstben och
nyckelben
D16.8
Benign tumör i bäckenben, sakrum
och koccyx
D17.9W
Annat lipom med ospecificerad
lokalisation
D16.9
Ospecificerad lokalisation av benign
tumör i ben och ledbrosk
D17.9X
Ospecificerat lipom med ospecificerad
lokalisation
D17
Lipom (fettsvulst)
D18
Hemangiom (blodkärlssvulst)
och lymfangiom
(lymfkärlssvulst), alla
lokalisationer
Neoplasma benignum
lipomatosum
Innefattar:
Morfologikoderna M885-M888 med
malignitetskod /0
Haemangioma et lymphangioma
quocumque loco
D17.0
Lipom i hud och subkutan vävnad i
huvudet, ansiktet och halsen
Innefattar:
Morfologikoderna M912-M917 med
malignitetskod /0
D17.1
Lipom i hud och subkutan vävnad på
bålen
Utesluter:
Blått nevus eller pigmentnevus (D22.-)
D17.2
Lipom i hud och subkutan vävnad på
extremiteterna
D18.0
Hemangiom, alla lokalisationer
D17.3
Lipom i hud och subkutan vävnad
med andra och ospecificerade
lokalisationer
D18.0A
Glomustumör
D18.0B
Kapillärt hemangiom
D18.0C
Kavernöst hemangiom i huden
D18.0E
Multipla progressiva angiom
Utesluter:
Peritoneum och retroperitonealrummet
(D17.7)
D18.0F
Targetoid hemosiderotiskt hemangiom
D18.0G
Verruköst keratotiskt hemangiom
D17.6
Lipom i sädesledare
D18.0H
Epitelioidalt hemangiom
D17.7
Lipom med andra specificerade
lokalisationer
D18.0J
Tufted angioma
D18.0W
Annat hemangiom
D18.0X
Hemangiom, ospecificerat
D18.1
Lymfangiom, alla lokalisationer
D18.1A
Kapillärt lymfangiom
D18.1B
Kavernöst lymfangiom
D18.1C
Cystiskt lymfangiom
D18.1X
Lymfangiom, ospecificerat
D17.4
Lipom i intratorakala organ
D17.5
Lipom i intraabdominella organ
Peritoneum
Retroperitonealrummet
D17.9
Ospecificerad lokalisation av lipom
Lipom UNS
D17.9A
Angiolipom med ospecificerad
lokalisation
D17.9B
Hibernom med ospecificerad
lokalisation
D17.9C
Medfödd diffus lipomatos med
ospecificerad lokalisation
D17.9D
Fibrolipom med ospecificerad
lokalisation
113
Angiom UNS
D19
Benign tumör i mesotelial
(kroppshåletäckande) vävnad
D21
Neoplasma benignum
mesotheliale
Alia neoplasmata benigna telae
connectivae et alterius telae
mollis
Innefattar:
Morfologikod M905 med malignitetskod
/0
D19.0
Benign tumör i mesotelial vävnad i
pleura
D19.1
Benign tumör i mesotelial vävnad i
peritoneum
D19.7
Benign tumör i mesotelial vävnad
med andra lokalisationer
D19.9
Ospecificerad lokalisation i mesotelial
vävnad
Innefattar:
Blodkärl
Brosk
Bursa
Ductus lymphaticus
Fascia
Fettvävnad
Ligament utom uterina ligament
Muskel
Sena (senskida)
Utesluter:
Bindväv i bröstkörtel (D24)
Brosk i:
• larynx (D14.1)
• leder (D16.-)
• näsan (D14.0)
Hemangiom (D18.0)
Lipom (D17.-)
Lymfangiom (D18.1)
Perifera nerver och autonoma
nervsystemet (D36.1)
Peritoneum (D20.1)
Retroperitoneum (D20.0)
Uterint leiomyom (D25.-)
Uterina ligament, samtliga (D28.2)
Vaskulär vävnad (D18.-)
Benignt mesoteliom UNS
D20
Benign tumör i mjukvävnad i
retroperitonealrummet
(utrymmet bakom bukhinnan)
och i peritoneum (bukhinnan)
Neoplasma benignum telae mollis
spatii retroperitonealis et peritonei
Utesluter:
Lipom i peritoneum och
retroperitonealrummet (D17.7)
Mesotelial vävnad (D19.-)
D20.0
D20.1
Andra benigna tumörer i
bindväv och annan
mjukvävnad
D21.0
Benign tumör i
retroperitonealrummet
Benign tumör i bindväv och annan
mjukvävnad i huvudet, ansiktet och
halsen
Ögonlock
Öra
Benign tumör i peritoneum
Utesluter:
Bindväv i ögonhåla (D31.6)
114
D21.1
Benign tumör i bindväv och annan
mjukvävnad i övre extremitet
inklusive skuldran
D21.2
Benign tumör i bindväv och annan
mjukvävnad i nedre extremitet
inklusive höften
D21.3
D22
Benign tumör i bindväv och annan
mjukvävnad i bröstkorgen
Naevi melanocytici
Innefattar:
Axill
De stora kärlen
Diafragma
Innefattar:
Morfologikoderna M872-M879 med
malignitetskod /0
Blått nevus
Hårigt nevus
Nevus UNS
Pigmentnevus
Utesluter:
Hjärtat (D15.1)
Mediastinum (D15.2)
Tymus (D15.0)
D21.4
D21.5
D21.6
Melanocytnevus
D22.0
Melanocytnevus på läpp
D22.1
Benign tumör i bindväv och annan
mjukvävnad i bäckenet
Melanocytnevus på ögonlock
inklusive ögonvrå
D22.2
Utesluter:
Uterina ligament, samtliga (D28.2)
Uterusmyom (D25.-)
Melanocytnevus på öra och yttre
hörselgång
D22.3
Melanocytnevus på andra och
ospecificerade delar av ansiktet
D22.4
Melanocytnevus i hårbotten och
halsen
D22.5
Melanocytnevus på bålen
Benign tumör i bindväv och annan
mjukvävnad i buken
Benign tumör i bindväv och annan
mjukvävnad på bålen med
ospecificerad lokalisation
Ryggen UNS
D21.9
Ospecificerad lokalisation av benign
tumör i bindväv och annan
mjukvävnad
D21.9A
Abrikossoffs tumör med ospecificerad
lokalisation
D22.6
Melanocytnevus på övre extremitet
inklusive skuldran
D21.9B
Angiomyom med ospecificerad
lokalisation
D22.7
Melanocytnevus på nedre extremitet
inklusive höften
D21.9C
Elastofibrom med ospecificerad
lokalisation
D22.9
Ospecificerad lokalisation av
melanocytnevus
D21.9D
Fibrom med ospecificerad lokalisation
D22.9A
D21.9E
Leiomyom med ospecificerad
lokalisation
Intraepidermalt pigmentnevus med
ospecificerad lokalisation
D22.9B
Pigmentnevus av junction-typ med
ospecificerad lokalisation
D22.9C
Intradermalt pigmentnevus med
ospecificerad lokalisation
D22.9D
Sammansatt pigmentnevus med
ospecificerad lokalisation
D22.9E
Kolinesterasnevus med ospecificerad
lokalisation
D21.9F
Myxom med ospecificerad lokalisation
D21.9X
Ospecificerad benign tumör i bindväv
och annan mjukvävnad med
ospecificerad lokalisation
115
Anala gränszonen
Anushuden
Huden över bröstkörtel
Perianala huden
D22.9F
D22.9G
D22.9H
D22.9J
Dysplastiskt nevus med ospecificerad
lokalisation
D23.0
Andra benigna tumörer i läpphuden
Utesluter:
På läpprödsgränsen (D10.0)
Halonevus med ospecificerad
lokalisation
D23.1
Halodermatit med ospecificerad
lokalisation
Andra benigna tumörer i huden på
ögonlock inklusive ögonvrå
D23.2
Kokardnevus med ospecificerad
lokalisation
Andra benigna tumörer i huden på
ytteröra och i yttre hörselgång
D23.3
Andra benigna tumörer i huden på
andra och ospecificerade delar av
ansiktet
D23.4
Andra benigna tumörer i hårbotten
och huden på halsen
D23.5
Andra benigna tumörer i huden på
bålen
D22.9K
Naevus spilus med ospecificerad
lokalisation
D22.9L
Melanonyki med ospecificerad
lokalisation
D22.9M
Blått nevus med ospecificerad
lokalisation
Anala gränszonen
Analhuden
Huden över bröstkörtel
Perianala huden
D22.9N
Spitz nevus med ospecificerad
lokalisation
D22.9Q
Reeds pigmenterade spolcellsnevus med
ospecificerad lokalisation
D22.9R
Mongolfläck med ospecificerad
lokalisation
D23.6
Andra benigna tumörer i huden på
övre extremitet inklusive skuldran
D22.9S
Beckers nevus med ospecificerad
lokalisation
D23.7
Andra benigna tumörer i huden på
nedre extremitet inklusive höften
D22.9T
Itos nevus med ospecificerad
lokalisation
D23.9
Ospecificerad lokalisation av andra
benigna tumörer i huden
D22.9W
Annat melanocytnevus med
ospecificerad lokalisation
D23.9A
Angiokeratom med ospecificerad
lokalisation
D22.9X
Ospecificerat melanocytnevus med
ospecificerad lokalisation
D23.9B
Apokrint hidrocystom med
ospecificerad lokalisation
D23
Andra benigna tumörer i huden
D23.9C
Cylindrom med ospecificerad
lokalisation
Innefattar:
Benign tumör i:
• hårfolliklar
• svettkörtlar
• talgkörtlar
D23.9D
Dermatofibrom med ospecificerad
lokalisation
D23.9E
Ekkrint hidradenom med ospecificerad
lokalisation
Utesluter:
Lipom (D17.0-D17.3)
Melanocytnevus (D22.-)
D23.9F
Naevus sebaceus senilis med
ospecificerad lokalisation
Alia neoplasmata benigna cutis
116
Utesluter:
Anus UNS (D12.9)
Huden på könsorganen (D28-D29)
D23.9G
Pilomatrixom med ospecificerad
lokalisation
D26.7
Andra benigna tumörer i andra delar
av uterus
D23.9H
Syringom med ospecificerad
lokalisation
D26.9
Ospecificerad lokalisation av andra
benigna tumörer i uterus
D23.9J
Trikofollikulom med ospecificerad
lokalisation
D27
D23.9K
Trikoepiteliom med ospecificerad
lokalisation
Benign tumör i ovarium
Neoplasma benignum ovarii
D28
Benign tumör i andra och
ospecificerade kvinnliga
könsorgan
Neoplasma benignum aliorum
organorum genitalium
femininorum et non
specificatorum
D23.9W
Andra benigna tumörer i huden med
ospecificerad lokalisation
D23.9X
Ospecificerad benign tumör i huden med
ospecificerad lokalisation
D24
Benign tumör i bröstkörtel
Innefattar:
Adenomatös polyp
Huden över kvinnliga könsorganen
Neoplasma benignum mammae
Innefattar:
Bröstets bindväv och mjukdelar
Utesluter:
Benign bröstkörteldysplasi (N60.-)
Huden över bröstkörteln (D22.5, D23.5)
D25
Benign tumör i vulva
D28.1
Benign tumör i vagina
D28.2
Benign tumör i äggledare och
ligament
Uterusmyom (muskelsvulst i
livmodern)
Tuba Fallopii
Uterusligament (breda) (runda)
Leiomyoma uteri
Innefattar:
Benign tumör i uterus med morfologikod
M889 och malignitetskod /0
Fibromyom i uterus
D25.0
Submuköst uterusmyom
D25.1
Intramuralt uterusmyom
D25.2
Subseröst uterusmyom
D25.9
Ospecificerad lokalisation av
uterusmyom
D26
D28.0
D28.7
Benign tumör i andra specificerade
lokalisationer i de kvinnliga
könsorganen
D28.9
Ospecificerad lokalisation av benign
tumör i de kvinnliga könsorganen
D29
Benign tumör i de manliga
könsorganen
Neoplasma benignum organorum
genitalium masculinorum
Innefattar:
Huden på manliga könsorganen
Andra benigna tumörer i
livmodern
D29.0
Benign tumör i penis
Alia neoplasmata benigna uteri
D29.1
Benign tumör i prostata
D26.0
Andra benigna tumörer i cervix uteri
D26.1
Andra benigna tumörer i corpus uteri
117
Utesluter:
Hyperplasi av prostata (adenomatös)
(N40)
Prostataförstoring (N40)
Prostatahypertrofi (N40)
D31
Benign tumör i öga och
närliggande vävnader
D29.2
Benign tumör i testis
D29.3
Benign tumör i epididymis
D29.4
Benign tumör i skrotum
Neoplasma benignum oculi et
organorum adnexorum
Benign tumör i andra manliga
könsorgan
Utesluter:
Bindväv och brosk i ögonlock (D21.0)
Synnerv (D33.3)
Ögonlockshuden (D22.1, D23.1)
D29.7
Huden på skrotum
Sädesblåsa
Sädesledare
Tunica vaginalis
D29.9
D30
D30.0
D31.0
Benign tumör i konjunktiva
D31.1
Benign tumör i kornea
D31.2
Benign tumör i retina
Benign tumör i urinorganen
D31.3
Benign tumör i korioidea
Neoplasma benignum organorum
urinariorum
D31.4
Benign tumör i ciliarkropp
D31.5
Benign tumör i tårkörtel och tårkanal
D31.6
Ospecificerad lokalisation av benign
tumör i orbita
Ospecificerad lokalisation av benign
tumör i de manliga könsorganen
Benign tumör i njure
Utesluter:
Njurbäcken (D30.1)
Njurkalyces (D30.1)
D30.1
Benign tumör i njurbäcken
D30.2
Benign tumör i uretär
Innefattar:
Bindväv i orbita
Perifera nerver i orbita
Retrobulbär vävnad
Retrookulär vävnad
Yttre ögonmuskler
Njurkalyces
Pelviuretära gränszonen
Utesluter:
Pelviuretära gränszonen (D30.1)
Uretärmynningen in mot blåsan (D30.3)
D30.3
D30.4
Benign tumör i urinblåsan
Utesluter:
Orbitalben (D16.4)
D31.9
Inre uretramynningen
Uretärinmynningen i blåsan
Uretärostiet
Benign tumör i uretra
D32
Benign tumör i centrala
nervsystemets hinnor
Neoplasma benignum meningum
cerebralium et spinalium
Benign tumör i andra specificerade
lokalisationer i urinorganen
Parauretrala körtlarna
D30.9
Ospecificerad lokalisation av benign
tumör i öga
Ögonglob
Utesluter:
Inre uretramynningen (D30.3)
D30.7
Ductus nasolacrimalis
Tårsäck
Ospecificerad lokalisation av benign
tumör i urinorganen
Urinorganen UNS
D32.0
Benign tumör i hjärnhinnor
D32.1
Benign tumör i ryggmärgshinnor
D32.9
Ospecificerad lokalisation av benign
tumör i centrala nervsystemets hinnor
Meningiom UNS
118
D33
Benign tumör i hjärnan och
andra delar av centrala
nervsystemet
D35
Neoplasma benignum cerebri et
aliarum partium systematis
nervosi centralis
Utesluter:
Ovarium (D27)
Pankreas endokrina del (D13.7)
Testis (D29.2)
Tymus (D15.0)
Utesluter:
Angiom (D18.0)
Centrala nervsystemets hinnor (D32.-)
Perifera nerver och autonoma
nervsystemet (D36.1)
Retrookulär vävnad (D31.6)
D33.0
Benign tumör i hjärnan,
supratentoriell lokalisation
Frontallob
Hjärnventrikel
Occipitallob
Parietallob
Temporallob
Utesluter:
Fjärde ventrikeln (D33.1)
D33.1
Benign tumör i hjärnan,
infratentoriell lokalisation
Fjärde ventrikeln
Hjärnstammen
Lillhjärnan
D33.2
Benign tumör med ospecificerad
lokalisation i hjärnan
D33.3
Benign tumör i kranialnerver
D33.4
Benign tumör i ryggmärgen
D33.7
Benign tumör i andra specificerade
delar av centrala nervsystemet
D33.9
Ospecificerad lokalisation av benign
tumör i centrala nervsystemet
D35.0
Benign tumör i binjure
D35.1
Benign tumör i paratyreoidea
D35.2
Benign tumör i hypofys
D35.3
Benign tumör i ductus
craniopharyngealis
D35.4
Benign tumör i corpus pineale
D35.5
Benign tumör i glomus caroticum
D35.6
Benign tumör i aortic body
(aortanära körtel) och andra
paraganglier
D35.7
Benign tumör i andra specificerade
endokrina körtlar
D35.8
Benign tumör med multiglandulär
lokalisation
D35.9
Ospecificerad lokalisation av benign
tumör i endokrin körtel
D36
Benign tumör med annan och
ospecificerad lokalisation
Neoplasma benignum loco alio et
non specificato
Nervsystemet (centrala) UNS
D34
Benign tumör i andra och
ospecificerade endokrina
körtlar
Neoplasma benignum aliarum
glandularum endocrinarum et non
specificatarum
Benign tumör i tyreoidea
(sköldkörteln)
D36.0
Benign tumör i lymfkörtlar
D36.1
Benign tumör i perifera nerver och
autonoma nervsystemet
Neoplasma benignum glandulae
thyreoideae
Utesluter:
Perifera nerver i orbita (D31.6)
D36.7
Benign tumör i andra specificerade
lokalisationer
Näsan UNS
D36.9
119
Ospecificerad lokalisation av benign
tumör
TUMÖRER AV OSÄKER ELLER OKÄND
NATUR (D37-D48)
D37.0A
Anmärkning:
Uttrycket ”patologiskt osäker natur” innebär
att man har tillgång till PAD men av
tumörens histopatologiska typ inte kan
avgöra om den är malign eller benign
(malignitetskod /1 i ICD:s
morfologiklassifikation, se sid. 745 i
KSH97). Uttrycket ”kliniskt okänd natur”
innebär att man inte har tillgång till PAD
och på kliniska grunder inte kan avgöra om
tumören är benign eller malign.
Neoplasmata naturae incertae sive
ignotae
Anmärkning:
Kategorierna D37-D48 används för att med avseende
på lokalisation klassificera tumörer av osäker eller
oklar natur, dvs. där osäkerhet föreligger om tumören
är malign eller benign. Under flertalet kategorier i
detta avsnitt förekommer nationella
fördjupningskoder (se bilaga), där femtepositionen A
står för ”patologiskt osäker natur” och B för ”kliniskt
okänd natur”. Uttrycket patologiskt osäker natur
innebär att man trots tillgång till PAD-utlåtande om
tumörens histopatologiska typ inte kan avgöra om
den är malign eller benign (malignitetskod /1 i
WHO:s morfologiklassifikation). Uttrycket "kliniskt
okänd natur" innebär att man inte har tillgång till
PAD-utlåtande och på kliniska grunder inte kan
avgöra om tumören är malign eller benign.
D37
Tumör av osäker eller okänd
natur i munhålan och
matsmältningsorganen
D37.0B
Tumör av kliniskt okänd natur i läpp,
munhåla och svalg
Anmärkning:
Se Anmärkning under D37.0A
D37.1
Tumör av osäker eller okänd natur i
magsäcken
D37.1A
Tumör av patologiskt osäker natur i
magsäcken
Anmärkning:
Se Anmärkning under D37.0A
Neoplasma naturae incertae sive
ignotae cavi oris et organorum
digestoriorum
D37.0
Tumör av patologiskt osäker natur i
läpp, munhåla och svalg
Tumör av osäker eller okänd natur i
läpp, munhåla och svalg
Aryepiglottiska vecket:
• hypofaryngeala delen
• marginala zonen
• UNS
De stora och små spottkörtlarna
Inom och på läpprödsgränsen
Utesluter:
Aryepiglottiska vecket, laryngeala delen
(D38.0)
Epiglottis UNS (D38.0)
Läpphuden (D48.5)
Suprahyoidala delen av epiglottis
(D38.0)
D37.1B
Tumör av kliniskt okänd natur i
magsäcken
Anmärkning:
Se Anmärkning under D37.0A
D37.2
Tumör av osäker eller okänd natur i
tunntarmen
D37.2A
Tumör av patologiskt osäker natur i
tunntarmen
Anmärkning:
Se Anmärkning under D37.0A
D37.2B
Tumör av kliniskt okänd natur i
tunntarmen
Anmärkning:
Se Anmärkning under D37.0A
D37.3
Tumör av osäker eller okänd natur i
appendix
D37.3A
Tumör av patologiskt osäker natur i
appendix
Anmärkning:
Se Anmärkning under D37.0A
D37.3B
Tumör av kliniskt okänd natur i
appendix
Anmärkning:
Se Anmärkning under D37.0A
120
D37.4
Tumör av osäker eller okänd natur i
tjocktarmen
D37.4A
Tumör av patologiskt osäker natur i
tjocktarmen
D37.7B
Tumör av osäker eller okänd natur i
rektum
Rektosigmoidala gränszonen
D37.5A
D37.9
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i
matsmältningsorganen
D38
Tumör av osäker eller okänd
natur i mellanöra,
andningsorganen och
bröstkorgens organ
Tumör av patologiskt osäker natur i
rektum
Neoplasma naturae incertae sive
ignotae auris mediae, organorum
respiratoriorum et
intrathoracalium
Anmärkning:
Se Anmärkning under D37.0A
D37.5B
Tumör av kliniskt okänd natur i rektum
Anmärkning:
Se Anmärkning under D37.0A
D37.6
Utesluter:
Hjärtat (D48.7)
Tumör av osäker eller okänd natur i
levern, gallblåsan och gallvägarna
D38.0
Ampulla Vateri
D37.6A
Tumör av patologiskt osäker natur i
levern, gallblåsan och gallvägarna
Utesluter:
Aryepiglottiska vecket:
• hypofaryngeala delen (D37.0)
• marginala zonen (D37.0)
• UNS (D37.0)
Tumör av kliniskt okänd natur i levern,
gallblåsan och gallvägarna
D38.0A
Anmärkning:
Se Anmärkning under D37.0A
D37.7
Tumör av osäker eller okänd natur i
larynx
Aryepiglottiska vecket, laryngeala delen
Epiglottis (suprahyoidala delen)
Anmärkning:
Se Anmärkning under D37.0A
D37.6B
Tumör av kliniskt okänd natur i andra
matsmältningsorgan
Anmärkning:
Se Anmärkning under D37.0A
Tumör av kliniskt okänd natur i
tjocktarmen
Anmärkning:
Se Anmärkning under D37.0A
D37.5
Tumör av patologiskt osäker natur i
andra matsmältningsorgan
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D37.4B
D37.7A
Tumör av patologiskt osäker natur i
larynx
Anmärkning:
Se Anmärkning under D37.0A
Tumör av osäker eller okänd natur i
andra matsmältningsorgan
Analkanalen
Analsfinktern
Anus UNS
Esofagus
Pankreas
Tarmen UNS
Utesluter:
Anala gränszonen (D48.5)
Analhuden (D48.5)
Perianala huden (D48.5)
D38.0B
Tumör av kliniskt okänd natur i larynx
Anmärkning:
Se Anmärkning under D37.0A
D38.1
Tumör av osäker eller okänd natur i
trakea, bronk och lunga
D38.1A
Tumör av patologiskt osäker natur i
trakea, bronk och lunga
Anmärkning:
Se Anmärkning under D37.0A
121
D38.1B
Tumör av kliniskt okänd natur i trakea,
bronk och lunga
D38.5A
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D38.2
Tumör av osäker eller okänd natur i
pleura
D38.2A
Tumör av patologiskt osäker natur i
pleura
D38.3A
D38.3B
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i
andningsorganen
D39
Tumör av osäker eller okänd
natur i de kvinnliga
könsorganen
Tumör av osäker eller okänd natur i
mediastinum
Neoplasma naturae incertae sive
ignotae organorum genitalium
femininorum
Tumör av patologiskt osäker natur i
mediastinum
Anmärkning:
Se Anmärkning under D37.0A
D39.0
Tumör av osäker eller okänd natur i
uterus
Tumör av kliniskt okänd natur i
mediastinum
D39.0A
Tumör av patologiskt osäker natur i
uterus
Anmärkning:
Se Anmärkning under D37.0A
D38.4
D38.4A
Anmärkning:
Se Anmärkning under D37.0A
Tumör av osäker eller okänd natur i
tymus
Tumör av patologiskt osäker natur i
tymus
Anmärkning:
Se Anmärkning under D37.0A
D38.4B
Tumör av kliniskt okänd natur i tymus
D39.0B
Tumör av kliniskt okänd natur i uterus
Anmärkning:
Se Anmärkning under D37.0A
D39.1
Tumör av osäker eller okänd natur i
ovarium
D39.1A
Tumör av patologiskt osäker natur i
ovarium
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D38.5
Tumör av patologiskt osäker natur i
andra andningsorgan
D38.6
Tumör av kliniskt okänd natur i pleura
Anmärkning:
Se Anmärkning under D37.0A
D38.3
D38.5A
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D38.2B
Tumör av patologiskt osäker natur i
andra andningsorgan
Tumör av osäker eller okänd natur i
andra andningsorgan
Mellanöra
Näsans bihålor
Näsbrosk
Näshålan
D39.1B
Tumör av kliniskt okänd natur i ovarium
Anmärkning:
Se Anmärkning under D37.0A
D39.2
Tumör av osäker eller okänd natur i
placenta
Chorioadenoma destruens
Hydatidiform mola:
• invasiv
• malign
Utesluter:
Näsa UNS (D48.7)
Näsans hud (D48.5)
Öra (ytteröra) (huden) (D48.5)
Utesluter:
Hydatidiform mola UNS (O01.9)
122
D40.1A
D39.2A
Invasiv mola
D39.2B
Misstänkt koriokarcinom
D39.2C
Placental site trophoblastic tumor
D39.2X
Tumör av osäker eller okänd natur i
placenta, ospecificerad
D39.7
Tumör av osäker eller okänd natur i
andra specificerade lokalisationer i de
kvinnliga könsorganen
Anmärkning:
Se Anmärkning under D37.0A
D40.1B
D40.7
Tumör av osäker eller okänd natur i
andra specificerade lokalisationer i de
manliga könsorganen
Huden på de manliga könsorganen
Tumör av patologiskt osäker natur i
andra specificerade lokalisationer i de
kvinnliga könsorganen
D40.7A
Anmärkning:
Se Anmärkning under D37.0A
D39.7B
Tumör av kliniskt okänd natur i testis
Anmärkning:
Se Anmärkning under D37.0A
Huden över kvinnliga könsorganen
D39.7A
Tumör av patologiskt osäker natur i
testis
Tumör av patologiskt osäker natur i
andra specificerade lokalisationer i de
manliga könsorganen
Anmärkning:
Se Anmärkning under D37.0A
Tumör av kliniskt okänd natur i andra
specificerade lokalisationer i de
kvinnliga könsorganen
D40.7B
Anmärkning:
Se Anmärkning under D37.0A
Tumör av kliniskt okänd natur i andra
specificerade lokalisationer i de manliga
könsorganen
Anmärkning:
Se Anmärkning under D37.0A
D39.9
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i de
kvinnliga könsorganen
D40.9
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i de
manliga könsorganen
D40
Tumör av osäker eller okänd
natur i de manliga
könsorganen
D41
Tumör av osäker eller okänd
natur i urinorganen
Neoplasma naturae incertae sive
ignotae organorum genitalium
masculinorum
D40.0
Tumör av osäker eller okänd natur i
prostata
D40.0A
Tumör av patologiskt osäker natur i
prostata
Neoplasma naturae incertae sive
ignotae organorum urinariorum
D41.0
Utesluter:
Njurbäcken (D41.1)
D41.0A
Anmärkning:
Se Anmärkning under D37.0A
D40.0B
Tumör av kliniskt okänd natur i prostata
Anmärkning:
Se Anmärkning under D37.0A
D40.1
Tumör av osäker eller okänd natur i
testis
123
Tumör av osäker eller okänd natur i
njure
Tumör av patologiskt osäker natur i
njure
Anmärkning:
Se Anmärkning under D37.0A
D41.0B
Tumör av kliniskt okänd natur i njure
Anmärkning:
Se Anmärkning under D37.0A
D41.1
Tumör av osäker eller okänd natur i
njurbäcken
D41.1A
Tumör av patologiskt osäker natur i
njurbäcken njure
D41.7A
Anmärkning:
Se Anmärkning under D37.0A
D41.1B
Anmärkning:
Se Anmärkning under D37.0A
Tumör av kliniskt okänd natur i
njurbäcken njure
D41.7B
Anmärkning:
Se Anmärkning under D37.0A
D41.2
D41.2A
Tumör av osäker eller okänd natur i
uretär
Tumör av patologiskt osäker natur i
uretär
Anmärkning:
Se Anmärkning under D37.0A
D41.2B
D41.9
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i
urinorganen
D42
Tumör av osäker eller okänd
natur i centrala nervsystemets
hinnor
Tumör av kliniskt okänd natur i uretär
D41.3
Tumör av osäker eller okänd natur i
uretra
D41.3A
Tumör av patologiskt osäker natur i
uretra
Anmärkning:
Se Anmärkning under D37.0A
D42.0
Tumör av osäker eller okänd natur i
hjärnhinnor
D42.0A
Tumör av patologiskt osäker natur i
hjärnhinnor
Anmärkning:
Se Anmärkning under D37.0A
D42.0B
D41.4
Tumör av osäker eller okänd natur i
urinblåsan
D41.4A
Tumör av patologiskt osäker natur i
urinblåsan
Anmärkning:
Se Anmärkning under D37.0A
Tumör av kliniskt okänd natur i
hjärnhinnor
Anmärkning:
Se Anmärkning under D37.0A
D42.1
Tumör av osäker eller okänd natur i
ryggmärgshinnor
D42.1A
Tumör av patologiskt osäker natur i
ryggmärgshinnor
Tumör av kliniskt okänd natur i
urinblåsan
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D41.7
Neoplasma naturae incertae sive
ignotae meningum cerebralium
sive spinalium
Tumör av kliniskt okänd natur i uretra
Anmärkning:
Se Anmärkning under D37.0A
D41.4B
Tumör av kliniskt okänd natur i andra
specificerade lokalisationer i
urinorganen
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D41.3B
Tumör av patologiskt osäker natur i
andra specificerade lokalisationer i
urinorganen
D42.1B
Tumör av osäker eller okänd natur i
andra specificerade lokalisationer i
urinorganen
Anmärkning:
Se Anmärkning under D37.0A
D42.9
124
Tumör av kliniskt okänd natur i
ryggmärgshinnor
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i centrala
nervsystemets hinnor
D43
Tumör av osäker eller okänd
natur i hjärnan och andra delar
av centrala nervsystemet
Neoplasma naturae incertae sive
ignotae cerebri et systematis
nervosi centralis
D43.3A
Anmärkning:
Se Anmärkning under D37.0A
D43.3B
Utesluter:
Perifera nerver och autonoma
nervsystemet (D48.2)
D43.0
Tumör av osäker eller okänd natur i
hjärnan, supratentoriell lokalisation
Tumör av patologiskt osäker natur i
ryggmärgen
Tumör av kliniskt okänd natur i
ryggmärgen
Anmärkning:
Se Anmärkning under D37.0A
Tumör av kliniskt okänd natur i hjärnan,
supratentoriell lokalisation
D43.7
Tumör av osäker eller okänd natur i
andra specificerade lokalisationer i
centrala nervsystemet
D43.7A
Tumör av patologiskt osäker natur i
andra specificerade lokalisationer i
centrala nervsystemet
Tumör av osäker eller okänd natur i
hjärnan, infratentoriell lokalisation
Fjärde ventrikeln
Hjärnstammen
Lillhjärnan
Anmärkning:
Se Anmärkning under D37.0A
D43.7B
Tumör av patologiskt osäker natur i
hjärnan, infratentoriell lokalisation
Tumör av kliniskt okänd natur i andra
specificerade lokalisationer i centrala
nervsystemet
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D43.1B
D43.4A
Tumör av patologiskt osäker natur i
hjärnan, supratentoriell lokalisation
Anmärkning:
Se Anmärkning under D37.0A
D43.1A
Tumör av osäker eller okänd natur i
ryggmärgen
D43.4B
Anmärkning:
Se Anmärkning under D37.0A
D43.1
D43.4
Anmärkning:
Se Anmärkning under D37.0A
Utesluter:
Fjärde ventrikeln (D43.1)
D43.0B
Tumör av kliniskt okänd natur i
kranialnerver
Anmärkning:
Se Anmärkning under D37.0A
Frontallob
Hjärnventrikel
Occipitallob
Parietallob
Temporallob
D43.0A
Tumör av patologiskt osäker natur i
kranialnerver
D43.9
Tumör av kliniskt okänd natur i hjärnan,
infratentoriell lokalisation
Anmärkning:
Se Anmärkning under D37.0A
D43.2
Tumör av osäker eller okänd natur
med ospecificerad lokalisation i
hjärnan
D43.3
Tumör av osäker eller okänd natur i
kranialnerver
125
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i centrala
nervsystemet
Nervsystemet (centrala) UNS
D44
Tumör av osäker eller okänd
natur i de endokrina körtlarna
D44.3A
Neoplasma naturae incertae sive
ignotae glandularum
endocrinarum
Utesluter:
Ovarium (D39.1)
Pankreas endokrina del (D37.7)
Testis (D40.1)
Tymus (D38.4)
D44.0
D44.0A
Tumör av osäker eller okänd natur i
tyreoidea
D44.1A
Tumör av kliniskt okänd natur i
hypofysen
D44.4
Tumör av osäker eller okänd natur i
ductus craniopharyngealis
D44.4A
Tumör av patologiskt osäker natur i
ductus craniopharyngealis
Anmärkning:
Se Anmärkning under D37.0A
D44.4B
Tumör av kliniskt okänd natur i
tyreoidea
Tumör av kliniskt okänd natur i ductus
craniopharyngealis
Anmärkning:
Se Anmärkning under D37.0A
Tumör av osäker eller okänd natur i
binjure
D44.5
Tumör av osäker eller okänd natur i
corpus pineale
D44.5A
Tumör av patologiskt osäker natur i
corpus pineale
Tumör av patologiskt osäker natur i
binjure
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D44.1B
D44.3B
Tumör av patologiskt osäker natur i
tyreoidea
Anmärkning:
Se Anmärkning under D37.0A
D44.1
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D44.0B
Tumör av patologiskt osäker natur i
hypofysen
D44.5B
Tumör av kliniskt okänd natur i binjure
Tumör av kliniskt okänd natur i corpus
pineale
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D44.2
Tumör av osäker eller okänd natur i
paratyreoidea
D44.6
Tumör av osäker eller okänd natur i
glomus caroticum
D44.2A
Tumör av patologiskt osäker natur i
paratyreoidea
D44.6A
Tumör av patologiskt osäker natur i
glomus caroticum
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D44.2B
D44.6B
Tumör av kliniskt okänd natur i
paratyreoidea
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D44.3
Tumör av kliniskt okänd natur i glomus
caroticum
Tumör av osäker eller okänd natur i
hypofysen
126
D44.7
Tumör av osäker eller okänd natur i
aortic body (aortanära körtel) och
andra paraganglier
D44.7A
Tumör av patologiskt osäker natur i
aortic body (aortanära körtel) och andra
paraganglier
Anmärkning:
Se Anmärkning under D37.0A
D44.7B
Tumör av kliniskt okänd natur i aortic
body (aortanära körtel) och andra
paraganglier
D46.0
Anmärkning:
Utan sideroblaster, utan blastöverskott
D46.1
Refraktär anemi med
ringsideroblaster
D46.2
Refraktär anemi med överskott av
blastceller [RAEB]
Anmärkning:
Se Anmärkning under D37.0A
D44.8
RAEB I
RAEB II
Tumör av osäker eller okänd natur
med multiglandulär lokalisation
Multipel endokrin adenomatos
D44.8A
Tumör med multiglandulär lokalisation,
typ I
D44.8B
Tumör med multiglandulär lokalisation,
typ II
D44.8C
Tumör med multiglandulär lokalisation,
typ III
D44.9
Ospecificerad lokalisation av tumör
av osäker eller okänd natur i
endokrin körtel
D45
D46.4
Refraktär anemi, ospecificerad
D46.5
Refraktär anemi med dysplasi av
multilinjärt ursprung
D46.6
Myelodysplastisk syndrom med
isolerad kromosomavvikelse av typ
del(5q)
5q-minus-syndrom
D46.7
Andra myelodysplastiska syndrom
Utesluter:
Kronisk myelomonocytleukemi (C93.1)
D46.9
Myelodysplastiskt syndrom,
ospecificerat
Myelodysplasi UNS
Preleukemi(syndrom) UNS
Polycythaemia vera (sjuklig
ökning av antalet röda
blodkroppar)
D47
Polycythaemia vera
Anmärkning:
Polycythaemia vera har klassificerats om
som malign i tredje upplagan av ICD-O.
Koden D45 kommer att fortsätta att
användas i ICD-10, trots att den är
placerad i avsnittet Tumörer av okänd
eller osäker natur. En ändring av
klassificeringen får vänta till ICD-11revisionen.
D46
Refraktär anemi utan
ringsideroblaster
Myelodysplastiska syndrom
Andra tumörer av osäker eller
okänd natur i lymfatisk,
blodbildande och besläktad
vävnad
Alia neoplasmata naturae
incertae sive ignotae telae
lymphaticae, haematopoieticae et
cognatae
D47.0
Histiocyt- och mastcellstumörer av
osäker och okänd natur
Indolent systemisk mastocytos
Mastcellstumör UNS
Mastocytom UNS
Systemisk mastocytos, associerad med
klonal hematopoetisk ickemastcellssjukdom (SM-AHNMD)
Syndromata myelodysplastica
Innefattar:
Myeloplastiskt syndrom relaterat till
alkylerande substanser
Myeloplastiskt syndrom relaterat till
epipodofyllotoxin
Utesluter:
Mastocytos (kongenital) (kutan) (Q82.2)
Utesluter:
Läkemedelsutlöst aplastisk anemi
(D61.1)
127
D47.1
D48.0
Kronisk myeloproliferativ sjukdom
Kronisk neutrofil leukemi
Myeloproliferativ sjukdom,
ospecificerad
Utesluter:
Bindväv i ögonlock (D48.1)
Brosk i:
• larynx (D38.0)
• näsan (D38.5)
• ögonlock (D48.1)
• öra (D48.1)
Synovialmembran (D48.1)
Utesluter:
Atypisk kronisk myeloisk leukemi
BCR/ABL-negativ (C92.2)
Kronisk myeloisk leukemi [KLM],
BCR/ABL-positiv (C92.1)
D47.2
Monoklonal gammopati av obestämd
signifikans [MGUS]
D47.3
Essentiell trombocytemi
D47.4
Osteomyelofibros
D48.0A
Kronisk idiopatisk myelofibros
Myelofibros (idiopatisk) (med myeloisk
metaplasi)
Myeloskleros (megakaryocytisk) med
myeloisk metaplasi
Sekundär myelofibros vid
myeloproliferativ sjukdom
D48.0B
Tumör av kliniskt okänd natur i ben och
ledbrosk
Anmärkning:
Se Anmärkning under D37.0A
D48.1
Tumör av osäker eller okänd natur i
bindväv och annan mjukvävnad
Bindväv och brosk i:
• ögonlock
• öra
D47.5
Kronisk eosinofil leukemi
[hypereosinofilt syndrom]
D47.7
Andra specificerade tumörer av
osäker eller okänd natur i lymfatisk,
blodbildande och besläktad vävnad
Histiocyttumörer av osäker eller okänd
natur
Ospecificerad tumör av osäker eller
okänd natur i lymfatisk, blodbildande
och besläktad vävnad
Lymfoproliferativ sjukdom UNS
D48
Tumör av patologiskt osäker natur i ben
och ledbrosk
Anmärkning:
Se Anmärkning under D37.0A
Idiopatisk hemorragisk trombocytemi
Utesluter:
Akut myelofibros (C94.4)
D47.9
Tumör av osäker eller okänd natur i
ben och ledbrosk
Tumör av osäker eller okänd
natur med annan och
ospecificerad lokalisation
Neoplasma naturae incertae sive
ignotae loco alio et non
specificato
Utesluter:
Neurofibromatos (icke malign) (Q85.0)
128
Utesluter:
Bindväv i bröstkörtel (D48.6)
Brosk i:
• larynx (D38.0)
• leder (D48.0)
• näsan (D38.5)
D48.1A
Angiomyxom
D48.1B
Desmoid
D48.1C
Medfödd generaliserad fibromatos
D48.1D
Aggressiv infantil fibromatos
D48.1E
Hemangiopericytom UNS
D48.1W
Annan tumör av osäker eller okänd natur
i bindväv och annan mjukvävnad
D48.2
Tumör av osäker eller okänd natur i
perifera nerver och autonoma
nervsystemet
Utesluter:
Perifera nerver i orbita (D48.7)
D48.2A
Tumör av patologiskt osäker natur i
perifera nerver och autonoma
nervsystemet
Anmärkning:
Se Anmärkning under D37.0A
D48.2B
D48.5D
Svettkörteltumör UNS
D48.5W
Annan tumör av osäker eller okänd natur
i huden
D48.6
Tumör av osäker eller okänd natur i
bröstkörtel
Tumör av kliniskt okänd natur i perifera
nerver och autonoma nervsystemet
Adenoma phyllodes
Bindväv i bröstkörtel
Anmärkning:
Se Anmärkning under D37.0A
Utesluter:
Huden över bröstkörtel (D48.5)
D48.3
Tumör av osäker eller okänd natur i
retroperitoneum
D48.3A
Tumör av patologiskt osäker natur i
retroperitoneum
D48.6B
D48.7
D48.4
Tumör av osäker eller okänd natur i
peritoneum
D48.4A
Tumör av patologiskt osäker natur i
peritoneum
Hjärtat
Perifera nerver i orbita
Öga
D48.7A
Tumör av kliniskt okänd natur i
peritoneum
D48.7B
Tumör av osäker eller okänd natur i
huden
Anala gränszonen
Analhuden
Huden över bröstkörtel
Perianala huden
D48.5B
Baddräktsnevus
D48.5C
Dysplastiskt nevus-syndrom
Tumör av kliniskt okänd natur i andra
specificerade lokalisationer
Anmärkning:
Se Anmärkning under D37.0A
D48.9
Ospecificerad lokalisation av tumör
av osäker eller okänd natur
Svulst UNS
Tumör UNS
Utesluter:
Anus UNS (D37.7)
Huden på könsorganen (D39.7, D40.7)
Inom och på läpprödsgränsen (D37.0)
Atypiskt fibroxantom
Tumör av patologiskt osäker natur i
andra specificerade lokalisationer
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D48.5A
Tumör av osäker eller okänd natur i
andra specificerade lokalisationer
Utesluter:
Bindväv (D48.1)
Huden på ögonlock (D48.5)
Anmärkning:
Se Anmärkning under D37.0A
D48.5
Tumör av kliniskt okänd natur i
bröstkörtel
Anmärkning:
Se Anmärkning under D37.0A
Tumör av kliniskt okänd natur i
retroperitoneum
Anmärkning:
Se Anmärkning under D37.0A
D48.4B
Tumör av patologiskt osäker natur i
bröstkörtel
Anmärkning:
Se Anmärkning under D37.0A
Anmärkning:
Se Anmärkning under D37.0A
D48.3B
D48.6A
129
Kapitel 3
Sjukdomar i blod och
blodbildande organ samt vissa
rubbningar i immunsystemet
(D50-D89)
Morbi sanguinis, systematis haematopoietici et
perturbationes immunosystematis
Utesluter:
Autoimmuna (systemiska) sjukdomar UNS (M35.9)
Endokrina sjukdomar, nutritionsrubbningar och ämnesomsättningssjukdomar (E00-E90)
Komplikationer vid graviditet, förlossning och under barnsängstid (O00-O99)
Medfödda missbildningar, deformiteter och kromosomavvikelser (Q00-Q99)
Sjukdom orsakad av humant immunbristvirus [HIV] (B20-B24)
Skador, förgiftningar och vissa andra följder av yttre orsaker (S00-T98)
Symtom, sjukdomstecken och onormala kliniska fynd och laboratoriefynd som ej klassificeras på
annan plats (R00-R99)
Tumörer (C00-D48)
Vissa perinatala tillstånd (P00-P96)
Detta kapitel innehåller följande avsnitt:
D50-D53 Nutritionsanemier
D55-D59 Hemolytiska anemier
D60-D64 Aplastiska och andra anemier
D65-D69 Koagulationsrubbningar, purpura och andra blödningstillstånd
D70-D77 Andra sjukdomar i blod och blodbildande organ
D80-D89 Vissa rubbningar i immunsystemet
Detta kapitel innehåller följande asteriskkoder:
D63* Anemi vid kroniska sjukdomar som klassificeras på annan plats
D77* Andra förändringar i blod och blodbildande organ vid sjukdomar som klassificeras på annan
plats
130
NUTRITIONSANEMIER (D50-D53)
D52.1
Anaemiae nutritionales
D50
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Järnbristanemi
Anaemia sideropenica
Innefattar:
Hypokrom anemi
Sideropen anemi
D50.0
D52.8
Andra specificerade folatbristanemier
D52.9
Folatbristanemi, ospecificerad
Folsyrebristanemi UNS
Järnbristanemi sekundär till kronisk
blodförlust
D53
Innefattar:
Megaloblastanemi som ej svarar på
vitamin B12- eller folatterapi
Utesluter:
Akut posthemorragisk anemi (D62)
Medfödd anemi orsakad av fetal
blodförlust (P61.3)
D53.0
D50.8
Andra specificerade järnbristanemier
D50.9
Järnbristanemi, ospecificerad
D51
Anemi på grund av vitamin B12brist
Anaemia e deficientia vitamini B12
Utesluter:
Lesch-Nyhans syndrom (E79.1)
D53.1
Utesluter:
Di Guglielmos sjukdom (C94.0)
D53.8
Kobolaminbristanemi
Medfödd brist på intrinsic factor
Perniciös anemi (medfödd)
Imerslund-Gräsbecks syndrom
Megaloblastisk hereditär anemi
D51.3
Annan dietär B12-bristanemi
Andra specificerade
nutritionsanemier
Anemi vid brist på:
• koppar
• molybden
• zink
B12-brist orsakad av selektiv B12malabsorption med proteinuri
Transkobalamin-II-brist
Anemi på grund av C-vitaminbrist
Utesluter:
Skörbjugg (E54)
B12-bristanemi orsakad av brist på
intrinsic factor
D51.2
Andra megaloblastanemier som ej
klassificeras på annan plats
Megaloblastanemi UNS
D53.2
Utesluter:
Vitamin B12-brist (E53.8)
D51.1
Proteinbristanemi
Aminosyrebristanemi
Orotacidurisk anemi
Sideropen dysfagi
Plummer-Vinsons syndrom
D51.0
Andra nutritionsanemier
Aliae anaemiae nutritionales
Posthemorragisk anemi (kronisk)
D50.1
Läkemedelsutlöst folatbristanemi
Utesluter:
Nutritionsbristtillstånd utan uppgift om
anemi såsom:
• kopparbrist (E61.0)
• molybdenbrist (E61.5)
• zinkbrist (E60)
Vegananemi
D51.8
Andra specificerade B12-bristanemier
D51.9
B12-bristanemi, ospecificerad
D52
Folatbristanemi
Anaemia e deficientia folatorum
D52.0
Dietär folatbristanemi
D53.9
Nutritionsanemi, ospecificerad
Utesluter:
Anemi UNS (D64.9)
Nutritionell megaloblastanemi
131
HEMOLYTISKA ANEMIER (BLODBRIST
PÅ GRUND AV ÖKAD NEDBRYTNING
AV RÖDA BLODKROPPAR) (D55-D59)
D56.1
Cooleys anemi
Svår beta-talassemi
Thalassaemia intermedia
Thalassaemia major
Anaemiae haemolyticae
D55
Anemi orsakad av
enzymrubbningar
Anaemia ex vitiis enzymaticis
Utesluter:
Läkemedelsutlöst enzymbristanemi
(D59.2)
D55.0
Anemi orsakad av glukos-6fosfatdehydrogenasbrist [G-6-PDbrist]
D56.2
Delta-beta-talassemi
D56.3
Anlagsbärare för talassemi
D56.4
Hereditär persistens av fetalt
hemoglobin [HPFH]
D56.8
Andra specificerade talassemier
D56.9
Talassemi, ospecificerad
Medelhavsanemi (med annan
hemoglobinopati)
Thalassaemia minor (blandad) (med
annan hemoglobinopati)
Favism
G-6-PD-bristanemi
D55.1
Anemi orsakad av andra rubbningar i
glutationomsättningen
Anemi (orsakad av):
• enzymbristtillstånd, utom G-6-PD,
som berör hexosmonofosfatshunten
[HMP-shunten]
• hemolytisk icke sfärocytisk
(hereditär), typ I
D55.2
Beta-talassemi
D57
Sicklecellssjukdomar
Morbi meniscocytici
Utesluter:
Andra hemoglobinopatier (D58.-)
D57.0
Sicklecellsanemi med kris
Hb-SS-sjukdom med kris
Anemi orsakad av rubbningar i
glykolytiska enzymer
D57.1
Anemi:
• hemolytisk icke sfärocytisk
(hereditär), typ II
• hexokinasbrist
• pyruvatkinasbrist [PK-brist]
• trios-fosfat-isomeras-brist
D57.2
Sicklecellsanemi utan kris
Sicklecellsanemi UNS
Sicklecellssjukdom UNS
Dubbel heterozygot sicklecellsanemi
Hb-SC-, Hb-SD- och Hb-SE-sjukdom
Sicklecell-talassemi
D55.3
Anemi orsakad av rubbningar i
nukleotidomsättningen
D57.3
D55.8
Andra specificerade anemier
orsakade av enzymrubbningar
D57.8
Andra sicklecellssjukdomar
D55.9
Anemi orsakad av enzymrubbning,
ospecificerad
D58
D56
Talassemi (medelhavsanemi)
Andra ärftliga hemolytiska
anemier (ärftlig blodbrist på
grund av ökad nedbrytning av
röda blodkroppar)
Hb-S-anlag [HbAS]
Heterozygot hemoglobin S
Aliae anaemiae haemolyticae
hereditariae
Thalassaemia
D56.0
Anlagsbärare för sicklecellsanemi
Alfa-talassemi
D58.0
Utesluter:
Hydrops fetalis orsakad av hemolytisk
sjukdom (P56.-)
Hereditär sfärocytos
Kongenital sfärocytisk hemolytisk ikterus
Minkowski-Chauffards syndrom
132
D58.1
Hereditär elliptocytos
D59.1A
Förvärvad hemolytisk anemi pga
köldantikroppar
D59.1B
Förvärvad hemolytisk anemi pga
värmeantikroppar
D59.1X
Förvärvad hemolytisk anemi,
autoimmun UNS
D59.2
Läkemedelsutlöst icke autoimmun
hemolytisk anemi
Elliptocytos (kongenital)
Ovalocytos (kongenital) (hereditär)
D58.2
Andra hemoglobinopatier
Abnormt hemoglobin UNS
Hb-C-sjukdom
Hb-D-sjukdom
Hb-E-sjukdom
Hemoglobinopati UNS
Hemolytisk sjukdom med instabilt
hemoglobin
Medfödd anemi med Heinz-kroppar
Läkemedelsutlöst enzymbristanemi
Utesluter:
Familjär polycytemi (D75.0)
Hb-M-sjukdom (D74.0)
Hereditär persistens av fetalt hemoglobin
[HPFH] (D56.4)
Methemoglobinemi (D74.-)
Polycytemi orsakad av hög höjd (D75.1)
D58.8
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
D59.3
Hemolytiskt-uremiskt syndrom
D59.4
Andra icke autoimmuna hemolytiska
anemier
Hemolytisk anemi:
• mekanisk
• mikroangiopatisk
• toxisk
Andra specificerade hereditära
hemolytiska anemier
Stomatocytos
D58.9
Tilläggskod kan användas för att ange yttre
orsak (kapitel 20)
Hereditär hemolytisk anemi,
ospecificerad
D59.5
D59
D59.0
Förvärvad hemolytisk anemi
(förvärvad blodbrist på grund
av ökad nedbrytning av röda
blodkroppar)
Anaemia haemolytica acquisita
Utesluter:
Hemoglobinuri UNS (R82.3)
D59.6
Hemoglobinuri orsakad av hemolys
av andra yttre orsaker
Hemoglobinuri orsakad av ansträngning
Marschhemoglobinuri
Paroxysmal köldhemoglobinuri
Läkemedelsutlöst autoimmun
hemolytisk anemi
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
D59.1
Paroxysmal nattlig hemoglobinuri
[Marchiafava-Micheli]
Tilläggskod kan användas för att ange yttre
orsak (kapitel 20)
Andra autoimmuna hemolytiska
anemier
Utesluter:
Hemoglobinuri UNS (R82.3)
Autoimmun hemolytisk sjukdom
Hemolytisk anemi:
• köldbetingad
(sekundär)(symtomatisk)
• värmebetingad
(sekundär)(symtomatisk)
Kroniskt köldagglutininsyndrom
Köldagglutininhemoglobinuri
Köldagglutininsjukdom
D59.8
Andra förvärvade hemolytiska
anemier
D59.9
Förvärvad hemolytisk anemi,
ospecificerad
Idiopatisk hemolytisk anemi, kronisk
Utesluter:
Evans syndrom (D69.3)
Hemolytisk sjukdom hos foster och
nyfödd (P55.-)
Paroxysmal köldhemoglobinuri (D59.6)
133
APLASTISK ANEMI (BLODBRIST PÅ
GRUND AV UPPHÖRD ELLER MINSKAD
BLODBILDNING I BENMÄRGEN) OCH
ANDRA ANEMIER (D60-D64)
Anaemia aplastica et aliae anaemiae
D60
Förvärvad isolerad aplasi av
röda blodkroppar [Aquired
pure red cell aplasia]
D61.2
Tilläggskod kan användas för att ange yttre
orsak (kapitel 20)
D61.3
Idiopatisk aplastisk anemi
D61.8
Andra specificerade aplastiska
anemier
D61.9
Aplastisk anemi, ospecificerad
Hypoplastisk anemi UNS
Medullär hypoplasi
Panmyeloftis
Erythroblastopenia acquisita
Innefattar:
Aplasi av röda blodkroppar
(förvärvad)(hos vuxen)(med tymom)
D62
D60.0
Kronisk förvärvad isolerad aplasi av
röda blodkroppar
D60.1
Övergående förvärvad isolerad aplasi
av röda blodkroppar
D60.8
Annan förvärvad isolerad aplasi av
röda blodkroppar
D60.9
Utesluter:
Medfödd anemi orsakad av fetal
blodförlust (P61.3)
D63*
Förvärvad isolerad aplasi av röda
blodkroppar, ospecificerad
Andra aplastiska anemier
(annan blodbrist på grund av
upphörd eller minskad
blodbildning i benmärgen)
D63.0*
Anemi vid tumörsjukdom (C00-D48†)
D63.8*
Anemi vid andra kroniska sjukdomar
som klassificeras på annan plats
Anemi vid kronisk njursvikt stadium 3-5
(N18.3-N18.9†)
Utesluter:
Agranulocytos (D70)
Konstitutionell aplastisk anemi
Aplasi av röda blodkroppar:
• hos barn
• medfödd
• primär
Blackfan-Diamonds syndrom
Familjär hypoplastisk anemi
Fanconis anemi
Pancytopeni med missbildningar
D61.1
Anemi vid kroniska sjukdomar
som klassificeras på annan
plats
Anaemia in aliis morbis chronicis
alibi classificatis
Aliae anaemiae aplasticae
D61.0
Anemi efter akut större
blödning
Anaemia acuta
posthaemorrhagica
Aquired pure red cell aplasia UNS
D61
Aplastisk anemi av andra yttre
orsaker
Läkemedelsutlöst aplastisk anemi
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
134
D64
Andra anemier
Aliae anaemiae
Utesluter:
Refraktär anemi:
• med överskott av blastceller (D46.2)
• med överskott av blastceller i
transformationsfas (C92.0)
• med sideroblaster (D46.1)
• utan sideroblaster (D46.0)
• UNS (D46.4)
D64.0
KOAGULATIONSRUBBNINGAR,
PURPURA (PUNKTFORMIGA
BLÖDNINGAR I HUDEN MM) OCH
ANDRA BLÖDNINGSTILLSTÅND
(D65-D69)
Defectus coagulationis, purpura et alii
status haemorrhagici
D65
Hereditär sideroblastisk anemi
Könsbunden hypokrom sideroblastisk
anemi
D64.1
Coagulatio intravascularis
disseminata
Sekundär sideroblastisk anemi
orsakad av sjukdom
Afibrinogenemi, förvärvad
Disseminated intravascular coagulation
[DIC]
Fibrinolytisk blödning, förvärvad
Fibrinolytisk purpura
Konsumtionskoagulopati
Purpura fulminans
Tilläggskod kan användas för att ange
orsakande sjukdom
D64.2
Sekundär sideroblastisk anemi
orsakad av läkemedel och toxiner
Tilläggskod kan användas för att ange yttre
orsak (kapitel 20)
D64.3
Utesluter:
Hos nyfödd (P60)
Som komplikation till:
• abort, extrauteringraviditet eller mola
(O00-O07, O08.1)
• graviditet, förlossning och under
barnsängstid (O45.0, O46.0, O67.0,
O72.3)
Andra sideroblastiska anemier
Sideroblastisk anemi som svarar på
pyridoxin och ej klassificeras på annan
plats
Sideroblastisk anemi UNS
Utesluter:
Myelodysplastiskt syndrom (D46.-)
D64.4
D66
Brist på faktor VIII (med funktionell
defekt)
Hemofili A
Hemofili UNS
Klassisk hemofili
Utesluter:
Blackfan-Diamonds syndrom (D61.0)
Di Guglielmos sjukdom (C94.0)
Utesluter:
Brist på faktor VIII med vaskulär defekt
(D68.0)
Andra specificerade anemier
Infantil pseudoleukemi
Leukoerytroblastisk anemi
D64.9
Ärftlig brist på faktor VIII
Deficientia hereditaria factoris VIII
Kongenital dyserytropoetisk anemi
Dyshematopoetisk anemi (kongenital)
D64.8
Disseminerad intravasal
koagulation
[defibrineringssyndrom]
Anemi, ospecificerad
D67
Ärftlig brist på faktor IX
Deficientia hereditaria factoris IX
Brist på:
• faktor IX (med funktionell defekt)
• plasmatromboplastinkomponent
[PTC]
Christmas disease
Hemofili B
135
D68
Andra koagulationsrubbningar
D68.3
Alii defectus coagulationis
Blödning under långtidsanvändning av
antikoagulantia
Hyperheparinemi
Ökning av:
• antitrombin
• anti VIIIa
• anti IXa
• anti Xa
• anti XIa
Utesluter:
Som komplikation till:
• abort, extrauteringraviditet och mola
(O00-O07, O08.1)
• graviditet, förlossning och under
barnsängstid (O45.0, O46.0, O67.0,
O72.3)
D68.0
von Willebrands sjukdom
Tilläggskod kan användas för att ange
tillförda antikoagulantia (kapitel 20)
Angiohemofili
Faktor VIII-brist med vaskulär defekt
Vaskulär hemofili
Utesluter:
Långtidsanvändning av antikoagulantia
utan blödning (Z92.1)
Utesluter:
Faktor VIII-brist:
• med funktionell defekt (D66)
• UNS (D66)
Kapillärskörhet (ärftlig) (D69.8)
D68.1
D68.4
Förvärvad brist på
koagulationsfaktor
Brist på koagulationsfaktor orsakad av:
• K-vitaminbrist
• leversjukdom
Hereditär brist på faktor XI
Hemofili C
Plasmatromboplastinprekursorbrist
[PTA-brist]
D68.2
Hemorragisk sjukdom orsakad av
cirkulerande antikoagulantia
Utesluter:
K-vitaminbrist hos nyfödd (P53)
D68.5
Hereditär brist på andra
koagulationsfaktorer
Primär trombofili
Aktiverat protein C (APC)-resistens
[faktor V Leiden-mutation]
Brist på:
• antitrombin
• protein C
• protein S
Protrombingenmutation
Brist på:
• AC-globulin
• proaccelerin
Brist på faktor:
• I [fibrinogen]
• II [protrombin]
• V [labil]
• VII [stabil]
• X [Stuart-Prower]
• XII [Hageman]
• XIII [fibrinstabiliserande]
Dysfibrinogenemi (kongenital)
Hypoprokonvertinemi
Kongenital afibrinogenemi
Owrens sjukdom
136
D68.5A
Aktiverat protein C (APC)-resistens
[faktor V Leiden-mutation]
D68.5B
Brist på antitrombin
D68.5C
Brist på protein C
D68.5D
Brist på protein S
D68.5E
Protrombingenmutation
D68.5W
Annan primär trombofili
D68.5X
Primär trombofili, ospecificerad
D68.6
D69.1
Annan trombofili
Antifosfolipidantikroppssyndrom
Kardiolipinantikroppssyndrom
Närvaro av lupusantikoagulans
Bernard-Souliers syndrom
[jättetrombocytsyndrom]
Glanzmanns sjukdom
Grey platelet syndrome
Trombasteni (hemorragisk) (hereditär)
Trombocytopati
Utesluter:
Disseminerad intravasal koagulation
(D65)
Hyperhomocysteinemi (E72.1)
D68.6A
Antifosfolipidantikroppssyndrom
D68.6B
Kardiolipinantikroppssyndrom
D68.6C
Närvaro av lupusantikoagulans
D68.6W
Annan specificerad trombofili
Kvalitativa trombocytdefekter
Utesluter:
von Willebrands sjukdom (D68.0)
D69.2
Annan ej trombocytbetingad purpura
Purpura:
• senil
• simplex
• UNS
D69.2A
Senil purpura
D68.6X
Annan trombofili, ospecificerad
D69.2B
Purpura simplex
D68.8
Andra specificerade
koagulationsrubbningar
D69.2C
Autoerytrocytsensibilisering
D68.9
Koagulationsrubbning, ospecificerad
D69.2D
Staspurpura
D69
Purpura (punktformiga
blödningar i huden mm) och
andra blödningstillstånd
D69.2X
Annan ej trombocytbetingad purpura,
ospecificerad
D69.3
Idiopatisk trombocytopen purpura
Evans syndrom
Immuntrombocytopeni
Purpura et alii status
haemorrhagici
D69.4
Utesluter:
Benign hypergammaglobulinemisk
purpura (D89.0)
Essentiell (hemorragisk) trombocytemi
(D47.3)
Kryoglobulinemisk purpura (D89.1)
Purpura fulminans (D65)
Trombotisk trombocytopen purpura
(M31.1)
D69.0
Annan primär trombocytopeni
Utesluter:
Trombocytopeni med avsaknad av radius
(Q87.2)
Wiskott-Aldrichs syndrom (D82.0)
Övergående neonatal trombocytopeni
(P61.0)
D69.5
Sekundär trombocytopeni
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
Allergisk purpura
Purpura:
• anafylaktoid
• Henoch-Schönlein
• icke trombocytopen (hemorragisk)
(idiopatisk)
• vaskulär
Vaskulit, allergisk
D69.6
Trombocytopeni, ospecificerad
D69.8
Andra specificerade hemorragiska
tillstånd
Kapillärskörhet (hereditär)
Vaskulär pseudohemofili
D69.9
Hemorragiskt tillstånd, ospecificerat
Tillstånd med blödningsbenägenhet UNS
137
ANDRA SJUKDOMAR I BLOD OCH
BLODBILDANDE ORGAN (D70-D77)
D72
Alii morbi leucocytici
Alii morbi sanguinis et systematis
haematopoietici
D70
Utesluter:
Basofili (D75.8)
Immunsjukdomar (D80-D89)
Neutropeni (D70)
Onormalt antal vita blodkroppar (R72)
Preleukemisyndrom (D46.9)
Agranulocytos
Agranulocytosis
Agranulocytär angina
Infantil genetisk agranulocytos
Kostmanns sjukdom
Neutropeni:
• cyklisk
• kongenital
• läkemedelsutlöst
• periodisk
• toxisk
• vid hypersplenism (primärt)
• UNS
Neutropen splenomegali
D72.0
Utesluter:
Chediak(-Steinbrinck)-Higashis syndrom
(E70.3)
Utesluter:
Övergående neonatal neutropeni (P61.5)
Agranulocytos
D70.9B
Kostmanns sjukdom
D70.9C
Neutropeni UNS
D70.9D
Shwachmans syndrom
D70.9W
Annan specificerad agranulocytos
D71
Funktionella rubbningar hos
polymorfkärniga neutrofila
celler (vissa vita blodkroppar)
Genetiskt betingade
leukocytanomalier
Granulocytanomali eller syndrom:
• Alder
• May-Hegglin
• Pelger-Huët
Hereditär:
• leukocytär hypersegmentering
• leukocytär hyposegmentering
• leukomelanopati
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
D70.9A
Andra sjukdomar i vita
blodkroppar
D72.1
Eosinofili
Allergisk eosinofili
Hereditär eosinofili
D72.1A
Eosinofili, allergisk
D72.1B
Eosinofili, hereditär
D72.1W
Annan form av eosinofili
D72.8
Andra specificerade sjukdomar i vita
blodkroppar
Leukemoid reaktion:
• lymfocytär
• monocytär
• myelocytär
Leukocytos
Lymfocytos (symtomatisk)
Lymfopeni
Monocytos (symtomatisk)
Plasmacytos
Dysfunctiones granulocytorum
neutrophilorum
segmentonuclearium
Defekt i cellmembranreceptorkomplex
[CR3]
Kongenital dysfagocytos
Kronisk granulomatös sjukdom (hos
barn)
Progressiv septisk granulomatos
D72.9
138
Sjukdom i vita blodkroppar,
ospecificerad
D73
Sjukdomar i mjälten
D75
Morbi lienales
D73.0
Alii morbi sanguinis et organorum
haematopoieticorum
Hyposplenism
Atrofi av mjälten
Postoperativ aspleni
Utesluter:
Förstorade lymfkörtlar (R59.-)
Hypergammaglobulinemi UNS (D89.2)
Lymfadenit:
• akut (L04.-)
• kronisk (I88.1)
• mesenteriell (akut) (kronisk) (I88.0)
• UNS (I88.9)
Utesluter:
Aspleni (kongenital) (Q89.0)
D73.1
Hypersplenism
Utesluter:
Splenomegali:
• kongenital (Q89.0)
• UNS (R16.1)
D73.2
Kronisk stasbetingad splenomegali
D73.3
Mjältabscess
D73.4
Mjältcysta
D73.5
Mjältinfarkt
D75.0
Utesluter:
Hereditär ovalocytos (D58.1)
D75.1
Andra specificerade sjukdomar i
mjälten
Mjältfibros UNS
Perisplenit
Splenit UNS
Sjukdom i mjälten, ospecificerad
D74
Methemoglobinemi
Utesluter:
Polycythaemia neonatorum (P61.1)
Polycythaemia vera (D45)
D75.8
Methaemoglobinaemia
D74.0
D75.9
Andra methemoglobinemier
Förvärvad methemoglobinemi (med
sulfhemoglobinemi)
Toxisk methemoglobinemi
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
D74.9
Andra specificerade sjukdomar i blod
och blodbildande organ
Basofili
Kongenital methemoglobinemi
Hemoglobin-M [Hb-M] sjukdom
Medfödd NADH-methemoglobinreduktasbrist
Methemoglobinemi, hereditär
D74.8
Sekundär polycytemi
Erytrocytos UNS
Polycytemi:
• emotionell
• förvärvad
• nefrogen
• relativ
• UNS
Polycytemi orsakad av:
• erytropoietin
• förlust av plasmavolym
• hög höjd
• stress
• syrebrist
Utesluter:
Traumatisk ruptur av mjälten (S36.0)
D73.9
Familjär erytrocytos
Benign polycytemi
Familjär polycytemi
Mjältruptur, icke traumatisk
Torsion av mjälten
D73.8
Andra sjukdomar i blod och
blodbildande organ
Methemoglobinemi, ospecificerad
139
Sjukdom i blod och blodbildande
organ, ospecificerad
D76
Andra specificerade sjukdomar
som engagerar lymforetikulär
och retikulohistiocytär vävnad
Alii morbi specificati ad telam
lymphoreticularem et
reticulohistiocyticum pertinentes
Mjältfibros vid schistosomiasis
[bilharzios] (B65.-†)
Hemofagocytisk lymfohistiocytos
Familjär hemofagocytisk retikulos
Histiocytos av mononukleära fagocyter
D76.2
Hemofagocytiskt syndrom,
infektionsassocierat
Tilläggskod kan användas för att ange
den infektiösa organismen eller
infektionssjukdomen
D76.3
Andra histiocytossyndrom
Retikulohistiocytom (jättecells)
Sinushistiocytos med massiv
lymfadenopati
Xantogranulom
D76.3A
Retikulohistiocytom (jättecells)
D76.3B
Sinushistiocytos med massiv
lymfadenopati [Rosai-Dorfman]
D76.3C
Juvenilt xantogranulom
D76.3D
Nekrobiotiskt xantogranulom
D76.3E
Benign cefalisk histiocytos
D76.3W
Andra histiocytossyndrom
Andra förändringar i blod och
blodbildande organ vid
sjukdomar som klassificeras
på annan plats
Aliae perturbationes sanguinis et
organorum haematopoieticorum
in morbis alibi classificatis
Utesluter:
Eosinofilt granulom (C96.6)
Hand-Schüller-Christians sjukdom
(C96.5)
Histiocytos X, multifokal (C96.5)
Histiocytos X, unifokal (C96.6)
Histiocytärt sarkom (C96.8)
Langerhanscellshistiocytos, multifokal
(C96.5)
Langerhanscellshistiocytos, unifokal
(C96.6)
Letterer-Siwes sjukdom (C96.0)
Malign histiocytos (C96.8)
Retikuloendotelios:
• leukemisk (C91.4)
• non-lipid (C96.0)
Retikulos
• histiocytär medullär (C96.8):
• lipomelanotisk (I89.8)
• malign UNS (C86.0)
D76.1
D77*
140
VISSA RUBBNINGAR I
IMMUNSYSTEMET (D80-D89)
D80.4
Selektiv brist på immunglobulin M
[IgM]
Perturbationes immunosystematis
D80.5
Innefattar:
Defekter i komplementsystemet
Immunbristsjukdomar utom sjukdomar orsakade av
humant immunbristvirus [HIV]
Sarkoidos
Immunbrist med ökning av
immunglobulin M [IgM]
D80.5A
Könsbundet hyper-IgM syndrom
D80.5W
Annan immunbrist med ökning av IgM
D80.6
Antikroppsbrist med nästan normala
immunglobuliner eller med
hyperimmunglobulinemi
D80.7
Övergående hypogammaglobulinemi
hos spädbarn
D80.8
Andra specificerade
immunbristtillstånd med
huvudsakligen antikroppsdefekter
Utesluter:
Autoimmun sjukdom (systemisk) UNS (M35.9)
Funktionella rubbningar hos polymorfkärniga
neutrofila celler (D71)
Sjukdom orsakad av humant immunbristvirus [HIV]
(B20-B24)
Sjukdom orsakad av humant immunbristvirus [HIV]
som komplicerar graviditet, förlossning och
barnsängstid (O98.7)
D80
Immunbrist med
huvudsakligen
antikroppsdefekter
Brist på lätt kappakedja
D80.9
Immunbrist med huvudsakligen
antikroppsdefekter, ospecificerad
D81
Kombinerade
immunbristtillstånd
Immunodeficientia cum imprimis
vitiis immunoglobulinorum
D80.0
Hereditär hypogammaglobulinemi
Autosomal recessiv agammaglobulinemi
(schweizisk typ)
Könsbunden agammaglobulinemi
[Bruton] (med tillväxthormonbrist)
D80.0A
D80.0B
D80.0W
D80.1
Hereditär agammaglobulinemi,
könsbunden
Hereditär agammaglobulinemi,
autosomalt recessiv
Annan hereditär
hypogammaglobulinemi
D80.3
Utesluter:
Autosomal recessiv agammaglobulinemi
(schweizisk typ) (D80.0)
D81.0
Svår kombinerad immunbrist [SCID]
med retikulär dysgenesi
D81.1
Svår kombinerad immunbrist [SCID]
med lågt antal T- och B-celler
D81.1A
SCID med lågt antal T- och B-celler,
autosomalt recessiv med RAG1/RAG2defekt
D81.1W
Annan SCID med lågt antal T- och Bceller
D81.2
Svår kombinerad immunbrist [SCID]
med lågt eller normalt antal B-celler
D81.2A
SCID med lågt eller normalt antal Bceller, könsbunden med mutationer i den
gemensamma gammakedjan för
interleukinreceptorer 2,4,7,9 och 15s
Icke familjär hypogammaglobulinemi
Agammaglobulinemi med
immunglobulinbärande B-lymfocyter
Common variable agammaglobulinemia
[CVA-gamma]
Hypogammaglobulinemi UNS
D80.2
Immunodeficientiae combinatae
Selektiv brist på immunglobulin A
[IgA]
Selektiv brist på immunglobulin G
[IgG]-subklasser
141
D81.2B
D81.2C
SCID med lågt eller normalt antal Bceller, autosomalt recessiv med JAK3defekt
Omenns syndrom
D81.2W
Annan definierad SCID med lågt eller
normalt antal B-celler
Immunbrist med korta extremiteter
D82.3
Immunbrist som åtföljer ärftligt
abnormt svar på Epstein-Barr-virus
Könsbunden lymfoproliferativ sjukdom
SCID med lågt eller normalt antal Bceller, autosomalt recessiv med ZAP7
0/SYK-defekt
D81.2D
D82.2
D82.4
Hyperimmunglobulin E [IgE]syndrom
D82.4A
Allergisk, IgE-förmedlad, reaktion
D82.4B
Allergisk, IgE-förmedlad,
sensibilisering utan reaktion
D82.4W
Annat hyperimmunglobulin E (IgE)syndrom
D81.3
Adenosindeaminasbrist [ADA-brist]
D81.4
Nezelofs syndrom
D81.5
Purinnukleosidfosforylasbrist [PNPbrist]
D82.8
Immunbrist vid andra specificerade
omfattande defekter
D81.6
Major histocompatibility complex
class I deficiency
D82.9
Immunbrist associerad med
omfattande defekt, ospecificerad
D83
Vanlig variabel immunbrist
Bare lymphocyte syndrome
D81.7
Major histocompatibility complex
class II deficiency
D81.8
Andra specificerade kombinerade
immunbristtillstånd
Immunodeficientia variabilis
communis
Common variable immunodeficiency
D83.0
Vanlig variabel immunbrist med
övervägande anomalier i B-cellernas
antal och funktion
D83.1
Vanlig variabel immunbrist med
övervägande rubbningar i
immunregulatoriska T-celler
Immunbrist i kombination med
andra omfattande defekter
D83.2
Vanlig variabel immunbrist med
autoantikroppar mot B- eller T-celler
Immunodeficientia cum aliis vitiis
majoribus combinata
D83.8
Annan vanlig variabel immunbrist
Utesluter:
Ataxia telangiectasia [Louis-Bar]
(G11.3)
D83.9
Vanlig variabel immunbrist,
ospecificerad
Wiskott-Aldrichs syndrom
D84
Andra immunbristtillstånd
Biotinberoende karboxylasbrist
D81.9
Kombinerad immunbrist,
ospecificerad
Svår kombinerad immunbristsjukdom
[SCID] UNS
D82
D82.0
Immunbrist med trombocytopeni och
eksem
D82.1
Aliae immunodeficientiae
Di Georges syndrom
Gälfickssyndrom
Tymisk alymfoplasi
Tymisk aplasi eller hypoplasi med
immunbrist
D84.0
Lymfocytfunktionsantigen-1-defekt
[LFA-1-defekt]
D84.1
Defekter i komplementsystemet
C1-esterasinhibitorbrist [C1-INH-brist]
Hereditärt angioödem
142
D84.8
Annan specificerad immunbrist
D84.8A
Immunologisk avvikelse vid kronisk
mukokutan candidiasis med eller utan
polyendokrinopati
D84.8B
Leukocytadhesions-defekt 2 (selektindefekt)
D84.8W
Annan specificerad immunbrist
D84.9
Immunbrist, ospecificerad
D89
Alii morbi immunosystematis non
alibi classificati
Utesluter:
Hyperglobulinemi UNS (R77.1)
Monoklonal gammopati av obestämd
signifikans [MGUS] (D47.2)
Transplantatsvikt och avstötning (T86.-)
D89.0
D86
Andra rubbningar i
immunsystemet som ej
klassificeras på annan plats
Polyklonal hypergammaglobulinemi
Benign hypergammaglobulinemisk
purpura
Polyklonal gammopati UNS
Sarkoidos
Sarcoidosis
Morbus Schaumann
D89.1
D86.0
Lungsarkoidos
D86.1
Sarkoidos i lymfkörtlar
D86.2
Lungsarkoidos med sarkoidos i
lymfkörtlar
D86.3
Sarkoidos i huden
D86.3A
Angiolupoid [Brocq-Pautrier]
D86.3B
Darier-Roussys sarkoid
D86.3D
Lupus pernio [Besnier-Tenneson]
D86.3E
Sarkoidos i ärr
D86.3W
Annan och ospecificerad sarkoidos i
huden
D86.8
Sarkoidos med andra och
kombinerade lokalisationer
Kryoglobulinemi:
• blandad
• essentiell
• idiopatisk
• primär
• sekundär
Kryoglobulinemisk purpura
Kryoglobulinemisk vaskulit
D89.2
Hypergammaglobulinemi,
ospecificerad
D89.3
Immunologiskt
rekonstitutionssyndrom [IRS]
Immune reconstitution inflammatory
syndrome [IRIS]
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Akut sarkoidos [Löfgrens syndrom]
Iridocyklit vid sarkoidos† (H22.1*)
Multipla kranialnervspareser vid
sarkoidos† (G53.2*)
Sarkoidos med:
• artropati† (M14.8*)
• myokardit† (I41.8*)
• myosit† (M63.3*)
Uveoparotitfeber [Heerfordts syndrom]
D86.9
Kryoglobulinemi
Sarkoidos, ospecificerad
143
D89.8
Andra specificerade sjukdomar som
engagerar immunsystemet som ej
klassificeras på annan plats
D89.9
Sjukdom som engagerar
immunsystemet, ospecificerad
Immunsjukdom UNS
Kapitel 4
Endokrina sjukdomar,
nutritionsrubbningar och
ämnesomsättningssjukdomar
(E00-E90)
Morbi systematis endocrini, nutritionis et
metabolismi
Anmärkning:
Alla tumörer skall klassificeras i kapitel 2 oavsett endokrin aktivitet.
Lämpliga koder i detta kapitel (dvs E05.8, E07.0, E16-E31, E34.-) kan användas som tilläggskoder
för att ange funktionell aktivitet hos tumörer och ektopisk endokrin vävnad. De kan även användas
vid hyperfunktion och hypofunktion hos endokrina körtlar vid tumörer och andra tillstånd som
klassificeras på annan plats
Utesluter:
Komplikationer vid graviditet, förlossning och under barnsängstid (O00-O99)
Symtom, sjukdomstecken och onormala kliniska fynd och laboratoriefynd som ej klassificeras på
annan plats (R00-R99)
Övergående endokrina rubbningar och ämnesomsättningssjukdomar specifika för foster och nyfödd
(P70-P74)
Detta kapitel innehåller följande avsnitt:
E00-E07 Sjukdomar i sköldkörteln
E10-E14 Diabetes
E15-E16 Andra rubbningar i glukosreglering och bukspottkörtelns inre sekretion
E20-E35 Sjukdomar i andra endokrina körtlar
E40-E46 Näringsbrist
E50-E64 Andra näringsbristtillstånd
E65-E68 Fetma och andra övernäringstillstånd
E70-E90 Ämnesomsättningssjukdomar
Detta kapitel innehåller följande asteriskkoder:
E35* Endokrina rubbningar vid sjukdomar som klassificeras på annan plats
E90* Rubbningar i nutrition och ämnesomsättning vid sjukdomar som klassificeras på annan plats
144
SJUKDOMAR I SKÖLDKÖRTELN
(E00-E07)
E01.0
Jodbristrelaterad diffus (endemisk)
struma
Morbi glandulae thyreoideae
E01.1
Jodbristrelaterad multinodulär
(endemisk) struma
E01.2
Jodbristrelaterad (endemisk) struma,
ospecificerad
E00
Medfött jodbristsyndrom
Syndroma congenitum
Endemisk struma UNS
deficientiae iodi
E01.8
Tilläggskod kan användas för att ange
samtidigt förekommande psykisk
utvecklingsstörning (F70-F79)
Innefattar:
Endemiska tillstånd förenade med
miljöbetingad jodbrist antingen direkt
eller som följd av jodbrist hos modern.
Vissa av tillstånden har ingen aktuell
hypotyreos men är en följd av otillräcklig
sekretion av tyreoideahormon hos foster
under utveckling. Miljöbetingade
strumogener kan vara bidragande.
Utesluter:
Subklinisk jodbristhypotyreos (E02)
E00.0
Förvärvad jodbristhypotyreos UNS
E02
E03
Utesluter:
Hypotyreos efter kirurgiska och
medicinska ingrepp (E89.0)
Jodbristrelaterad hypotyreos (E00-E02)
E03.0
Endemisk kretinism:
• hypotyreotisk typ
• myxödematös typ
E00.2
Medfött jodbristsyndrom, blandad
typ
Utesluter:
Övergående medfödd struma med
normal funktion (P72.0)
Medfött jodbristsyndrom,
ospecificerat
Endemisk kretinism UNS
Medfödd jodbristhypotyreos UNS
E01
Medfödd hypotyreos med diffus
struma
Medfödd struma:
• parenkymatös
• UNS
Endemisk kretinism, blandad typ
E00.9
Annan hypotyreos
(underfunktion av sköldkörteln)
Alia hypothyreosis
Medfött jodbristsyndrom, neurologisk
typ
Medfött jodbristsyndrom,
myxödematös typ
Subklinisk jodbristhypotyreos
(underfunktion av sköldkörteln)
Hypothyreosis subclinica e
deficientia iodi
Endemisk kretinism, neurologisk typ
E00.1
Andra jodbristrelaterade
sköldkörtelsjukdomar och därmed
sammanhängande tillstånd
Jodbristrelaterade
sköldkörtelsjukdomar och
därmed sammanhängande
tillstånd
E03.1
Medfödd hypotyreos utan struma
E03.2
Hypotyreos orsakad av läkemedel och
andra exogena substanser
Aplasi och hypoplasi av tyreoidea (med
myxödem)
Medfödd hypotyreos UNS
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
Morbi thyreoideae e deficientia
iodi et status cognati
Utesluter:
Medfött jodbristsyndrom (E00.-)
Subklinisk jodbristhypotyreos (E02)
E03.3
Postinfektiös hypotyreos
E03.4
Förvärvad atrofi av tyreoidea
Utesluter:
Medfödd atrofi av tyreoidea (E03.1)
145
E03.5
Myxödemkoma
E03.8
Annan specificerad hypotyreos
E03.9
Hypotyreos, ospecificerad
E04
Annan atoxisk struma (struma
utan överfunktion)
Utesluter:
Jodbristrelaterad struma (E00-E02)
Medfödd struma:
• diffus (E03.0)
• parenkymatös (E03.0)
• UNS (E03.0)
E05.4
Thyreotoxicosis factitia
(överkonsumtion av
sköldkörtelhormon)
E05.5
Tyreotoxisk kris
E05.8
Annan tyreotoxikos
Atoxisk diffus (kolloid) struma
Atoxisk enkel struma
Atoxisk uninodulär struma
E04.2
Atoxisk multinodulär struma
Annan specificerad atoxisk struma
E04.9
Atoxisk struma, ospecificerad
E05.9
Tyreotoxikos, ospecificerad
E06
Sköldkörtelinflammation
Utesluter:
Postpartumtyreoidit (O90.5)
E06.0
Nodulär (atoxisk) struma UNS
Struma UNS
E06.1
Tyreotoxikos [hypertyreos]
(överfunktion av sköldkörteln)
E05.2
Abscess i tyreoidea
Varig tyreoidit
Subakut tyreoidit
de Quervains tyreoidit
Granulomatös tyreoidit
Icke varig tyreoidit
Jättecellstyreoidit
Utesluter:
Autoimmun tyreoidit (E06.3)
Utesluter:
Kronisk tyreoidit med övergående
tyreotoxikos (E06.2)
Neonatal tyreotoxikos (P72.1)
E05.1
Akut tyreoidit
Tilläggskod (B95-B97) kan användas för
att ange den infektiösa organismen
Thyreotoxicosis
E05.0
Hypertyreos UNS
Tyreotoxisk hjärtsjukdom† (I43.8*)
Thyreoiditis
Cystisk struma UNS
Multinodulär cystisk struma UNS
E04.8
Överproduktion av
tyreoideastimulerande hormon [TSH]
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
Atoxisk diffus struma
E04.1
E05
Tyreotoxikos beroende på ektopisk
tyreoideavävnad
Myxödem UNS
Alia struma atoxica
E04.0
E05.3
E06.2
Kronisk tyreoidit med övergående
tyreotoxikos
Utesluter:
Autoimmun tyreoidit (E06.3)
Tyreotoxikos med diffus struma
Basedows sjukdom
Exoftalmisk eller toxisk struma UNS
Graves sjukdom
Toxisk diffus struma
Tyreotoxikos med toxisk uninodulär
struma
Tyreotoxikos med toxisk
multinodulär struma
E06.3
Autoimmun tyreoidit
E06.4
Läkemedelsutlöst tyreoidit
Hashimotos tyreoidit
Lymfadenoid struma
Lymfocytär tyreoidit
Struma lymphomatosa
Tilläggskod kan användas för att ange
orsakande läkemedel (Kapitel 20)
Toxisk nodulär struma UNS
146
E06.5
DIABETES (E10-E14)
Annan kronisk tyreoidit
Diabetes mellitus
Kronisk fibrös tyreoidit
Kronisk tyreoidit UNS
Riedels tyreoidit
Tilläggskod kan användas för att ange orsakande
läkemedel om läkemedelsutlöst (kapitel 20)
Följande fjärdepositioner används för kategorierna
E10-E14:
E06.9
Tyreoidit, ospecificerad
E07
Andra sjukdomar i sköldkörteln
Aliae perturbationes thyreoideae
E07.0
Hypersekretion av kalcitonin
E07.1
Dyshormogen struma
C-cellshyperplasi i tyreoidea
Hypersekretion av tyreokalcitonin
Familjär struma med
hormonsyntesdefekt
Pendreds syndrom
.1 Med ketoacidos
Diabetisk
• acidos utan uppgift om koma
• ketoacidos utan uppgift om koma
Andra specificerade sjukdomar i
sköldkörteln
Abnormitet i tyreoideahormonbindande
globulin
Blödning i tyreoidea
Infarkt i tyreoidea
Sick-euthyroid syndrome
E07.9
Diabetiskt:
• hyperosmolärt koma
• hypoglykemiskt koma
• koma med ketoacidos
• koma utan ketoacidos
Hyperglykemiskt koma UNS
Utesluter:
Icke diabetiskt hypoglykemiskt koma (E15)
Utesluter:
Transitorisk medfödd struma med
normal funktion (P72.0)
E07.8
.0 Med koma
Sjukdom i sköldkörteln, ospecificerad
.2† Med njurkomplikationer
Diabetesnefropati (N08.3*)
Intrakapillär glomerulonefros (N08.3*)
Kimmelstiel-Wilsons syndrom (N08.3*)
.3† Med ögonkomplikationer
Diabeteskatarakt (H28.0*)
Diabetesretinopati (H36.0*)
.4† Med neurologiska komplikationer
Diabetes med:
• amyotrofi (G73.0*)
• autonom neuropati (G99.0*)
• autonom polyneuropati (G99.0*)
• mononeuropati (G59.0*)
• polyneuropati (G63.2*)
.5 Med perifera cirkulationsrubbningar
Diabetesgangrän
Diabetiskt sår
Perifer diabetesangiopati† (I79.2*)
.6 Med andra specificerade komplikationer
Diabetisk artropati† (M14.2*)
Diabetisk neuropatisk artropati† (M14.6*)
Diabetesosteopati† (M90.8*)
.7 Med multipla komplikationer
.8 Med ospecificerade komplikationer
.9 Utan komplikationer
147
E10
E10.2A
Diabetes mellitus typ 1
Diabetes mellitus generis 1
Diabetes mellitus typ 1 med incipient
nefropati
Innefattar:
Med mikroalbuminuri
Anmärkning:
Se ovan för fjärdepositionsindelningar
E10.2B
Innefattar:
Diabetes
• brittle
• juvenil typ
• ketosbenägen
Insulin-dependent diabetes mellitus
(IDDM)
Diabetes mellitus typ 1 med manifest
nefropati
Innefattar:
Med albuminuri
Med kreatininstegring
Utesluter:
Diabetes (vid):
• graviditet, förlossning och under
barnsängstid (O24.-)
• neonatal (P70.2)
• näringsbristrelaterad (E12.-)
Glukosuri:
• renal (E74.8)
• UNS (R81)
Hypoinsulinism efter kirurgiska ingrepp
(E89.1)
Patologisk glukostolerans (R73.0)
E10.2C
Diabetes mellitus typ 1 med (grav)
njurinsufficiens
E10.2W
Diabetes mellitus typ 1 med annan
specificerad njurkomplikation
E10.2X
Diabetes mellitus typ 1 med
njurkomplikation UNS
E10.3A
Diabetes mellitus typ 1 med
bakgrundsretinopati
E10.3B
Diabetes mellitus typ 1 med
preproliferativ retinopati (PPDR)
E10.0A
Diabetes mellitus typ 1 med
ketoacidotiskt koma
E10.3C
Diabetes mellitus typ 1 med proliferativ
retinopati
E10.0B
Diabetes mellitus typ 1 med
hyperosmolärt koma
E10.3D
Diabetes mellitus typ 1 med avancerad
ögonsjukdom
E10.0C
Diabetes mellitus typ 1 med
hypoglykemiskt koma
Innefattar:
Med irisrubeos
Med neovaskulärt glaukom
Med traktion i glaskroppen
Utesluter:
Hypoglykemi utan koma (E10.6A)
Icke diabetiskt hypoglykemiskt koma
(E15)
E10.0D
Diabetes mellitus typ 1 med
laktacidotiskt koma
E10.0X
Diabetes mellitus typ 1 med koma UNS
E10.1A
Diabetes mellitus typ 1 med ketoacidos
E10.1B
Diabetes mellitus typ 1 med
hyperosmolaritet
E10.1D
Diabetes mellitus typ 1 med laktacidos
E10.1X
Diabetes mellitus typ 1 med acidos eller
hyperosmolaritet UNS
148
E10.3E
Diabetes mellitus typ 1 med kliniskt
signifikant makulaödem
E10.3F
Diabetes mellitus typ 1 med (diabetisk)
katarakt
E10.3W
Diabetes mellitus typ 1 med annan
specificerad ögonkomplikation
E10.3X
Diabetes mellitus typ 1 med
ögonkomplikation UNS
E10.4B
Diabetes mellitus typ 1, autonom
neuropati
Innefattar:
Med gastropares
Med erektiv dysfunktion
Med blåsrubbning
E10.4C
E11
Diabetes mellitus typ 1 med
mononeuropati (akut)
Diabetes mellitus typ 2
Diabetes mellitus generis 2
E10.4D
Diabetes mellitus typ 1 med
polyneuropati (distal symmetrisk)
E10.4E
Diabetes mellitus typ 1 med (diabetisk)
amyotrofi
E10.4W
Diabetes mellitus typ 1med annan
specificerad neurologisk komplikation
E10.4X
Diabetes mellitus typ 1 med neurologisk
komplikation UNS
E10.5A
Diabetes mellitus typ 1 med perifer
angiopati (utan gangrän)
E10.5B
Diabetes mellitus typ 1 med perifer
angiopati med gangrän
E10.5W
Diabetes mellitus typ 1 med annan
perifer kärlkomplikation
E10.5X
Diabetes mellitus typ 1 med perifer
kärlkomplikation UNS
E11.0A
E10.6A
Diabetes mellitus typ 1 med
hypoglykemi utan koma
Diabetes mellitus typ 2 med
ketoacidotiskt koma
E11.0B
Diabetes mellitus typ 2 med
hyperosmolärt koma
E11.0C
Diabetes mellitus typ 2 med
hypoglykemiskt koma
Anmärkning:
Se ovan för fjärdepositionsindelningar
Innefattar:
Med insulinkänningar
Utesluter:
Hypoglykemi med koma (E10.0C)
E10.6D
Innefattar:
Diabetes (adipös, nonadipös):
• icke ketotisk
• vuxen typ
Ej insulinberoende diabetes hos ungdom
Non-insulin-dependent diabetes mellitus
(NIDDM)
Utesluter:
Diabetes (vid):
• graviditet, förlossning och under
barnsängstid (O24.-)
• neonatal (P70.2)
• näringsbristrelaterad (E12.-)
Glukosuri:
• renal (E74.8)
• UNS (R81)
Hypoinsulinism efter kirurgiska ingrepp
(E89.1)
Patologisk glukostolerans (R73.0)
Utesluter:
Hypoglykemi utan koma (E11.6A)
Icke diabetiskt hypoglykemiskt koma
(E15)
Diabetes mellitus typ 1 med (diabetiskt)
fotsår
Innefattar:
”Den diabetiska foten”
E10.6E
Diabetes mellitus typ 1 med annan
komplikation från hud och subkutan
vävnad
E10.6F
Diabetes mellitus typ 1 med
muskuloskeletal komplikation
Innefattar:
Med artropati
Med osteopati
E10.6G
Diabetes mellitus typ 1 med periodontal
komplikation
E10.6W
Diabetes mellitus typ 1 med annan
specificerad komplikation
149
E11.0D
Diabetes mellitus typ 2 med
laktacidotiskt koma
E11.0X
Diabetes mellitus typ 2 med koma UNS
E11.1A
Diabetes mellitus typ 2 med ketoacidos
E11.1B
Diabetes mellitus typ 2 med
hyperosmolaritet
E11.1D
Diabetes mellitus typ 2 med laktacidos
E11.1X
Diabetes mellitus typ 2 med acidos eller
hyperosmolaritet UNS
E11.2A
E11.4C
Diabetes mellitus typ 2 med
mononeuropati (akut)
Innefattar:
Med mikroalbuminuri
E11.4D
Diabetes mellitus typ 2 med
polyneuropati (distal symmetrisk)
Diabetes mellitus typ 2 med manifest
nefropati
E11.4E
Innefattar:
Med albuminuri
Med kreatininstegring
Diabetes mellitus typ 2 med (diabetisk)
amyotrofi
E11.4W
Diabetes mellitus typ 2 med annan
specificerad neurologisk komplikation
E11.2C
Diabetes mellitus typ 2 med (grav)
njurinsufficiens
E11.4X
Diabetes mellitus typ 2 med neurologisk
komplikation UNS
E11.2W
Diabetes mellitus typ 2 med annan
specificerad njurkomplikation
E11.5A
Diabetes mellitus typ 2 med perifer
angiopati (utan gangrän)
E11.2X
Diabetes mellitus typ 2 med
njurkomplikation UNS
E11.5B
Diabetes mellitus typ 2 med perifer
angiopati med gangrän
E11.3A
Diabetes mellitus typ 2 med
bakgrundsretinopati
E11.5W
Diabetes mellitus typ 2 med annan
perifer kärlkomplikation
E11.3B
Diabetes mellitus typ 2 med
preproliferativ retinopati (PPDR)
E11.5X
Diabetes mellitus typ 2 med perifer
kärlkomplikation UNS
E11.3C
Diabetes mellitus typ 2 med proliferativ
retinopati
E11.6A
Diabetes mellitus typ 2 med
hypoglykemi (utan koma)
E11.3D
Diabetes mellitus typ 2 med avancerad
ögonsjukdom
Innefattar:
Med insulinkänningar
Innefattar:
Med irisrubeos
Med neovaskulärt glaukom
Med traktion i glaskroppen
Utesluter:
Hypoglykemi med koma (E11.0C)
E11.2B
Diabetes mellitus typ 2 med incipient
nefropati
E11.6D
E11.3E
Diabetes mellitus typ 2 med kliniskt
signifikant makulaödem
E11.3F
Diabetes mellitus typ 2 med (diabetisk)
katarakt
E11.3W
Diabetes mellitus typ 2 med annan
specificerad ögonkomplikation
E11.3X
Diabetes mellitus typ 2 med
ögonkomplikation UNS
E11.4B
Diabetes mellitus typ 2 med autonom
neuropati
Diabetes mellitus typ 2 med (diabetiskt)
fotsår
Innefattar:
”Den diabetiska foten”
E11.6E
Diabetes mellitus typ 2 med annan
komplikation från hud och subkutan
vävnad
E11.6F
Diabetes mellitus typ 2 med
muskuloskeletal komplikation
Innefattar:
Med artropati
Med osteopati
Innefattar:
Med gastropares
Med erektiv dysfunktion
Med blåsrubbning
150
E11.6G
Diabetes mellitus typ 2 med periodontal
komplikation
E11.6W
Diabetes mellitus typ 2 med annan
specificerad komplikation
E12
Näringsbristrelaterad diabetes
Diabetes mellitus malnutritionalis
Anmärkning:
Se ovan för fjärdepositionsindelning
Innefattar:
Näringsbristrelaterad diabetes mellitus:
• typ 1
• typ 2
Utesluter:
Diabetes vid graviditet, förlossning och
under barnsängstid (O24.-)
Glukosuri:
• renal (E74.8)
• UNS (R81)
Hypoinsulinism efter kirurgiska ingrepp
(E89.1)
Neonatal diabetes mellitus (P70.2)
Patologisk glukostolerans (R73.0)
E13
Annan specificerad diabetes
Alius diabetes mellitus
specificatus
Anmärkning:
Se ovan för fjärdepositionsindelning
Utesluter:
Diabetes (vid):
• graviditet, förlossning och under
barnsängstid (O24.-)
• neonatal (P70.2)
• näringsbristrelaterad (E12.-)
• typ 1 (E10.-)
• typ 2 (E11.-)
Glukosuri:
• renal (E74.8)
• UNS (R81)
Hypoinsulinism efter kirurgiska ingrepp
(E89.1)
Patologisk glukostolerans (R73.0)
151
E14
Ospecificerad diabetes
Diabetes mellitus non
specificatus
Anmärkning:
Se ovan för fjärdepositionsindelning
Innefattar:
Diabetes UNS
Utesluter:
Diabetes (vid):
• graviditet, förlossning och under
barnsängstid (O24.-)
• neonatal (P70.2)
• näringsbristrelaterad (E12.-)
• typ 1(E10.-)
• typ 2 (E11.-)
Glukosuri:
• renal (E74.8)
• UNS (R81)
Hypoinsulinism efter kirurgiska ingrepp
(E89.1)
Patologisk glukostolerans (R73.0)
ANDRA RUBBNINGAR I
GLUKOSREGLERING OCH
BUKSPOTTKÖRTELNS INRE
SEKRETION (E15-E16)
Alii perturbationes regulationis glucosi
et secretionis internae pancreatis
E15
Hyperinsulinism med hypoglykemiskt
koma
Hypoglykemiskt koma UNS
Läkemedelsutlöst insulinkoma hos icke
diabetiker
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
Andra rubbningar i
bukspottkörtelns inre sekretion
Aliae dysfunctiones endocrinae
pancreatis
E16.0
Oregelbunden sekretion av gastrin
E16.8
Andra specificerade rubbningar i
pankreas inre sekretion
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Annan hypoglykemi
E16.1A
Hyperinsulinism UNS
E16.1B
Betacellshyperplasi UNS
E16.1C
Nesidioblastos
E16.1W
Annan specificerad hypoglykemi
E16.2
Hypoglykemi, ospecificerad
E16.3
Överproduktion av glukagon
E16.8C
Överproduktion av pankreatisk
polypeptid
E16.8D
Överproduktion av somatostatin
E16.8E
Överproduktion av VIP (vasoactive
intestinal peptide)
E16.8F
Insulinresistens
E16.8X
Överproduktion av pankreatiskt hormon
UNS
E16.9
Rubbning i bukspottkörtelns inre
sekretion, ospecificerad
Hyperplasi av pankreas endokrina celler
UNS
Öcellshyperplasi UNS
Läkemedelsutlöst hypoglykemi utan
koma
E16.1
Hypergastrinemi
Zollinger-Ellisons syndrom
Ökad sekretion från pankreas endokrina
del av:
• growth hormone-releasing hormone
[GHRH]
• pankreatisk polypeptid [PPP]
• somatostatin
• vasoaktiv intestinal polypeptid [VIP]
Icke diabetiskt hypoglykemiskt
koma (djup medvetslöshet på
grund av glukosbrist)
Coma hypoglychaemicum non
diabeticum
E16
E16.4
Encefalopati efter hypoglykemiskt koma
Funktionell hyperinsulinism
Funktionell icke hyperinsulinemisk
hypoglykemi
Hyperinsulinism UNS
Hyperplasi av pankreasöarnas betaceller
UNS
Hyperplasi av pankreas endokrina celler
med glukagonöverskott
152
SJUKDOMAR I ANDRA ENDOKRINA
KÖRTLAR (E20-E35)
E21.2
Utesluter:
Galaktorré (N64.3)
Gynekomasti (N62)
Hypoparatyreoidism
(underfunktion av
bisköldkörtel)
Hypoparathyreoidismus
Utesluter:
Di Georges syndrom (D82.1)
Hypoparatyreoidism efter kirurgiska och
medicinska ingrepp (E89.2)
Tetani UNS (R29.0)
Transitorisk neonatal
hypoparatyreoidism (P71.4)
E20.0
Idiopatisk hypoparatyreoidism
E20.1
Pseudohypoparatyreoidism
E20.8
Annan specificerad
hypoparatyreoidism
E20.9
Hypoparatyreoidism, ospecificerad
E21
Hyperparatyreoidism, ospecificerad
E21.4
Andra specificerade sjukdomar i
bisköldkörtlarna
E21.5
Sjukdom i bisköldkörtlarna,
ospecificerad
E22
Hyperfunktion av hypofysen
Hyperfunctio hypophysis
Utesluter:
Cushings syndrom (E24.-)
Nelsons syndrom (E24.1)
Överproduktion av:
• hypofysärt ACTH (E24.0)
• icke hypofysärt ACTH (E27.0)
• tyreoideastimulerande hormon [TSH]
(E05.8)
Tetani beroende på bristande
paratyreoideafunktion
Hyperparatyreoidism
(överfunktion av bisköldkörtel)
och andra sjukdomar i
bisköldkörtlarna
Utesluter:
Infantil och juvenil osteomalaci (E55.0)
Osteomalaci hos vuxen (M83.-)
E21.1
E21.3
E22.0
Hyperparathyreoidismus et aliae
dysfunctiones parathyreoideae
E21.0
Tertiär hyperparatyreoidism
Utesluter:
Familjär hypokalciurisk hyperkalcemi
(E83.5)
Morbi aliarum glandularum systematis
endocrini
E20
Annan hyperparatyreoidism
Primär hyperparatyreoidism
Hyperplasi av paratyreoidea
Osteitis fibrosa cystica generalisata [von
Recklinghausens sjukdom i benvävnad]
Utesluter:
Sekundär hyperparatyreoidism av renalt
ursprung (N25.8)
153
Artropati förenad med akromegali†
(M14.5*)
Överproduktion av tillväxthormon
Utesluter:
Konstitutionell gigantism (E34.4)
Ökad sekretion från pankreas endokrina
del av growth hormone-releasing
hormone (E16.8)
E22.1
Hyperprolaktinemi
E22.2
Abnorm sekretion av antidiuretiskt
hormon
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
Syndrome of inappropriate secretion of
antidiuretic hormone [SIADH]
E22.8
Annan specificerad hyperfunktion av
hypofysen
Centralt betingad tidig pubertet
E22.9
Sekundär hyperparatyreoidism som
ej klassificeras på annan plats
Akromegali och hypofysär gigantism
Hyperfunktion av hypofysen,
ospecificerad
E23
Hypofunktion och andra
sjukdomar i hypofysen
E23.3
Utesluter:
Prader-Willis syndrom (Q87.1)
Russell-Silvers syndrom (Q87.1)
Hypofunctio et aliae
dysfunctiones hypophysis
Innefattar:
Listade tillstånd vare sig sjukdomen är i
hypofysen eller hypotalamus
Utesluter:
Hypopituitarism efter kirurgiska och
medicinska ingrepp (E89.3)
E23.0
Hypopituitarism
Fertilt eunuck-syndrom
Hypofysär:
• insufficiens UNS
• kakexi
• kortvuxenhet
Hypogonadotrop hypogonadism
Idiopatisk brist på tillväxthormon
Isolerad brist på:
• gonadotropin
• hypofyshormon
• tillväxthormon
Kallmanns syndrom
Lorain-Levi-kortvuxenhet
Nekros av hypofysen (postpartum)
Panhypopituitarism
Sheehans syndrom
Simmonds sjukdom
Hypotalamisk dysfunktion som ej
klassificeras på annan plats
E23.6
Andra specificerade rubbningar i
hypofysen
Adiposogenital dystrofi
Hypofysabscess
E23.7
Rubbning i hypofysen, ospecificerad
E24
Cushings syndrom
(överproduktion av
binjurebarkhormoner)
Syndroma Cushing
E24.0
Hypofysberoende Cushings sjukdom
E24.1
Nelsons syndrom
E24.2
Läkemedelsutlöst Cushings syndrom
E24.3
Ektopiskt ACTH-syndrom
Hypofysberoende hyperadrenokorticism
Överproduktion av hypofysärt ACTH
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
E23.0A
Bristande produktion av tillväxthormon
(idiopatisk)
E24.4
Alkoholutlöst pseudocushingsyndrom
E23.0B
Bristande produktion av prolaktin
E24.8
Annat specificerat Cushings syndrom
E23.0C
Bristande produktion av ACTH
E24.9
Cushings syndrom, ospecificerat
E23.0D
Bristande produktion av TSH
E25
E23.0E
Bristande produktion av gonadotropiner
Adrenogenitala rubbningar
(rubbningar i binjurens
produktion av könshormon)
E23.0F
Panhypopituitarism
E23.0W
Andra former av hypofysunderfunktion
E23.0X
Hypofunktion hypofys UNS
E23.1
Läkemedelsutlöst hypopituitarism
E23.2
Diabetes insipidus
Perturbationes adrenogenitales
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Utesluter:
Nefrogen diabetes insipidus (N25.1)
154
Innefattar:
Adrenogenitala syndrom, viriliserande
eller feminiserande, både förvärvade och
orsakade av binjurehyperplasi som följd
av medfödda enzymdefekter i
hormonsyntesen
I förtid utvecklade pubertetstecken på
grund av binjurehyperplasi (hos pojke)
Macrogenitosomia praecox (tidig tillväxt
av könsorganen)
Virilisering av flicka och kvinna
E25.0
Kongenitala adrenogenitala
rubbningar förenade med enzymbrist
Kongenital binjurebarkshyperplasi
Kongenital saltförlorande
binjurebarkshyperplasi
21-hydroxylas-brist
E25.0A
Binjurebarkshyperplasi, kongenital, med
saltförlust
Binjurebarkshyperplasi, kongenital, med
enzymbrist
E25.0C
Pseudohermafroditism, adrenal, kvinnlig
E25.0D
Macrogenitosomia praecox
E25.8
Andra specificerade adrenogenitala
rubbningar
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
E27.1
Addisonkris
E27.3
Läkemedelsutlöst
binjurebarksinsufficiens
E27.4
E26.8
Annan specificerad
hyperaldosteronism
Annan och ospecificerad
binjurebarksinsufficiens
Utesluter:
Adrenoleukodystrofi [Addison-Schilder]
(E71.3)
Waterhouse-Friderichsens syndrom
(A39.1)
Conns syndrom
Primär aldosteronism orsakad av
binjurebarkshyperplasi (bilateral)
E27.5
Binjuremärgshyperfunktion
E27.8
Andra specificerade sjukdomar i
binjure
Bartters syndrom
E26.9
Adrenokortikal kris
Binjurebarksinsufficiens UNS
Binjureblödning
Binjureinfarkt
Hypoaldosteronism
Hyperaldosteronismus
Sekundär hyperaldosteronism
Addisons sjukdom
Autoimmun adrenalit
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Hyperaldosteronism
(överproduktion av aldosteron)
E26.1
Primär binjurebarksinsufficiens
E27.2
Adrenogenitalt syndrom UNS
Primär hyperaldosteronism
Prematur adrenarke
Överproduktion av ACTH icke förenad
med Cushings sjukdom
Utesluter:
Cushings syndrom (E24.-)
Adrenogenital rubbning,
ospecificerad
E26.0
Annan överaktivitet i binjurebarken
Utesluter:
Amyloidos (E85.-)
Tuberkulös Addisons sjukdom (A18.7)
Waterhouse-Friderichsens syndrom
(A39.1)
Idiopatisk adrenogenital rubbning
E26
Andra sjukdomar i binjurarna
Aliae perturbationes suprarenales
E27.0
E25.0B
E25.9
E27
Hyperaldosteronism, ospecificerad
Binjuremärgshyperplasi
Hypersekretion av katekolaminer
Rubbning i kortisonbindande globulin
E27.9
155
Binjuresjukdom, ospecificerad
E28
E28.0
Rubbningar i äggstockarnas
funktion
E29.0
Testikulär hyperfunktion
Dysfunctio ovarialis
E29.1
Testikulär hypofunktion
Utesluter:
Isolerad gonadotropinbrist (E23.0)
Ovarial insufficiens efter kirurgiska och
medicinska ingrepp (E89.4)
Defekt biosyntes av testikulära
androgener UNS
Testikulär hypogonadism UNS
5-alfa-reduktasbrist (med manlig
pseudohermafroditism)
Överskott av östrogener
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
E28.1
E29.8
Annan specificerad testikulär
dysfunktion
E29.9
Testikulär dysfunktion, ospecificerad
E30
Pubertetsstörningar som ej
klassificeras på annan plats
Överskott av androgener
Hypersekretion av ovariala androgener
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
E28.2
Polycystiska ovarier
E28.3
Primär ovarial svikt
Perturbationes pubertatis non
alibi classificatae
Sklerocystiskt ovariesyndrom
Stein-Leventhals syndrom
För tidig menopaus UNS
Minskad mängd östrogener
Resistent ovarium
Utesluter:
Isolerad gonaddysgenesi (Q99.1)
Kvinnligt klimakterium (N95.1)
Turners syndrom (Q96.-)
E28.8
Hypersekretion av testikulära hormoner
E30.0
Försenad pubertet
E30.1
För tidig pubertet
Ovarial hyperfunktion UNS
Ovarial dysfunktion, ospecificerad
E29
Rubbningar i testiklarnas
funktion
För tidig menstruation
Utesluter:
Albrights(-McCune)(-Sternbergs)
syndrom (Q78.1)
Centralt betingad tidig pubertet (E22.8)
I förtid utvecklade pubertetstecken vid
binjurebarkshyperplasi (E25.-)
Kongenital binjurebarkshyperplasi
(E25.0)
Annan specificerad ovarial
dysfunktion
E28.9
Försenad sexuell utveckling
Konstitutionell försening av puberteten
E30.8
Andra specificerade
pubertetsstörningar
Prematur telarke
Dysfunctio testicularis
Utesluter:
Androgen resistens (E34.5)
Azoospermi eller oligospermi UNS
(N46)
Isolerad gonadotropinbrist (E23.0)
Klinefelters syndrom (Q98.0-Q98.2,
Q98.4)
Testikulär feminisering (E34.5)
Testikulär hypofunktion efter medicinskt
eller kirurgiskt ingrepp (E89.5)
156
E30.9
Pubertetsstörning, ospecificerad
E31
Samtidig rubbning i flera
inresekretoriska organ
E34.0
Anmärkning:
Kan användas som tilläggskod för att
identifiera funktionell aktivitet förenad
med en karcinoidtumör
Dysfunctio polyglandularis
endocrina
Utesluter:
Ataxia telangiectasia [Louis-Bar]
(G11.3)
Dystrophia myotonica [Steinert] (G71.1)
Pseudohypoparatyreoidism (E20.1)
E31.0
Autoimmun polyglandulär
insufficiens
Autoimmun polyendokrinopati typ I och
typ II
Schmidts syndrom
E31.1
E34.1
Annan hypersekretion av intestinala
hormoner
E34.2
Ektopisk hormonsekretion som ej
klassificeras på annan plats
E34.3
Kortvuxenhet som ej klassificeras på
annan plats
Kortvuxenhet:
• konstitutionell
• Laron-typ
• psykosocialt betingad
• UNS
Polyglandulär hyperfunktion
Utesluter:
Multipel endokrin adenomatos (D44.8)
E31.8
Annan specificerad polyglandulär
dysfunktion
E31.9
Polyglandulär dysfunktion,
ospecificerad
E32
Sjukdomar i tymus
Utesluter:
Förkortade extremiteter med
immundefekt (D82.2)
Kortvuxenhet:
• akondroplastisk (Q77.4)
• hypofysär (E23.0)
• hypokondroplastisk (Q77.4)
• nutritionellt betingad (E45)
• renal (N25.0)
• vid specificerade dysmorfa syndrom klassificeras på syndromet i fråga
Progeria (E34.8)
Russell-Silvers syndrom (Q87.1)
Morbi thymi
Utesluter:
Aplasi eller hypoplasi med immundefekt
(D82.1)
Myasthenia gravis (G70.0)
E32.0
Karcinoidsyndrom
E34.3A
Kortvuxenhet, konstitutionell
E34.3B
Kortvuxenhet, psykosocialt betingad
E34.3C
Kortvuxenhet, Laron-typ
E34.3D
Kortvuxenhet efter intrauterin
tillväxthämning (SGA) och/eller
underburenhet
E34.3X
Kortvuxenhet UNS
E34.4
Konstitutionell högvuxenhet
Aliae dysfunctiones endocrinae
E34.4A
Långvuxenhet, konstitutionell
Utesluter:
Pseudohypoparatyreoidism (E20.1)
E34.4X
Långvuxenhet UNS
Bestående hyperplasi av tymus
Hypertrofi av tymus
E32.1
Abscess i tymus
E32.8
Andra specificerade sjukdomar i
tymus
E32.9
Sjukdom i tymus, ospecificerad
E34
Andra endokrina rubbningar
157
Konstitutionell gigantism
E34.5
NÄRINGSBRIST (E40-E46)
Androgen resistens
Androgenokänslighetssyndrom
Manlig pseudohermafroditism med
androgenresistens
Reifensteins syndrom
Sjukdom i perifer androgenreceptor
Testikulär feminisering
E34.5A
Testikulär feminisering
E34.5B
Pseudohermafroditism, manlig, med
androgenresistens
E34.5W
Annan specificerad androgenresistens
E34.8
Andra specificerade endokrina
rubbningar
Malnutritio
Anmärkning:
Graden av malnutrition mäts vanligen i termer av
vikt, uttryckt i standarddeviationer av medelvärdet i
en relevant referenspopulation. När en eller flera
tidigare mätningar finns tillgängliga tyder avsaknad
av viktökning hos barn eller tecken på viktförlust hos
barn eller vuxna vanligen på näringsbrist. När bara ett
mätvärde föreligger baseras diagnosen på
sannolikheter och är ej definitiv utan andra kliniska
undersökningar eller laboratorieundersökningar. I de
sällsynta fall där ingen vikt finns tillgänglig bör man
stödja sig på klinisk bedömning.
Om en observerad vikt ligger under medelvärdet hos
referenspopulationen, är det en hög sannolikhet att en
allvarlig näringsbrist föreligger då det observerade
värdet befinner sig 3 eller flera standarddeviationer
under medelvärdet hos referenspopulationen. En hög
sannolikhet för måttlig näringsbrist föreligger för ett
värde som ligger mellan 2 och 3 standarddeviationer
under detta medelvärde och en hög sannolikhet för
lätt undernäring föreligger för ett observerat värde
som ligger mellan 1 och 2 standarddeviationer under
detta medelvärde.
Dysfunktion i corpus pineale
Progeria
E34.8B
Progeri [Hutchinson-Gilford]
E34.8C
Leprechaunism
E34.8D
Werners syndrom
E34.8E
Akrogeri [Gottron]
E34.8W
Andra specificerade endokrina
rubbningar
E34.9
Endokrin rubbning, ospecificerad
E35*
Utesluter:
Extrem avmagring vid HIV-infektion (B22.2)
Följdtillstånd efter protein-energiundernäring (E64.0)
Intestinal malabsorption (K90.-)
Nutritionsanemier (D50-D53)
Endokrin störning UNS
Hormonell störning UNS
E40
Endokrina rubbningar vid
sjukdomar som klassificeras
på annan plats
Malnutritio proteinica grav
Svår undernäring med ödem och
dyspigmentering av hud och hår
Utesluter:
Svår protein-energiundernäring (E42)
Dysfunctiones endocrinae in
morbis alibi classificatis
E35.0*
Sjukliga förändringar i tyreoidea vid
sjukdomar som klassificeras på annan
plats
E41
Svår undernäring med marasm
Utesluter:
Svår protein-energiundernäring (E42)
Sjukliga förändringar i binjurarna
vid sjukdomar som klassificeras på
annan plats
Tuberkulös Addisons sjukdom (A18.7†)
Waterhouse-Friderichsens syndrom
(orsakad av meningokocker) (A39.1†)
E35.8*
Svår energiundernäring
Marasmus nutritionalis
Tuberkulos i tyreoidea (A18.8†)
E35.1*
Svår proteinundernäring
[Kwashiorkor]
Andra endokrina rubbningar vid
sjukdomar som klassificeras på annan
plats
158
E42
Svår protein-energiundernäring
Malnutritio proteinica marantica
Svår protein-energiundernäring
[definierad som under E43]:
• intermediär form
• med tecken på både kwashiorkor och
marasm
E43
Ospecificerad svår
undernäring
E45
Malnutritio proteinica gravis non
specificata
Retardatio corporalis e
malnutritione proteinica
Anmärkning:
Svår viktförlust hos barn eller vuxna
eller avsaknad av viktuppgång hos barn
som leder till en observerad vikt som är
åtminstone 3 standarddeviationer under
medelvärdet hos referenspopulationen
(eller liknande förlust uttryckt med andra
statistiska mått). När endast en
viktmätning föreligger, är det stor
sannolikhet för svår viktförlust när
vikten är 3 eller fler standarddeviationer
under medelvärdet hos
referenspopulationen.
E44
Protein-energiundernäring av
måttlig och lätt grad
Malnutritio proteinica modica et
levis
E44.0
Måttlig protein-energiundernäring
Anmärkning:
Viktförlust hos barn eller vuxna eller
avsaknad av viktuppgång hos barn som
leder till en observerad vikt som är minst
2 men mindre än 3 standarddeviationer
under medelvärdet hos
referenspopulationen (eller liknande
förlust uttryckt med andra statistiska
mått). När endast en viktmätning
föreligger är det stor sannolikhet för
måttlig protein-energiundernäring när
den observerade vikten är minst 2 men
mindre än 3 standarddeviationer under
medelvärdet hos referenspopulationen.
E44.1
Försenad utveckling efter
protein-energiundernäring
Lätt protein-energiundernäring
Anmärkning:
Viktförlust hos barn eller vuxna eller
avsaknad av viktuppgång hos barn som
leder till en observerad vikt som är minst
1 men mindre än 2 standarddeviationer
under medelvärdet hos
referenspopulationen (eller liknande
förlust uttryckt med andra statistiska
mått). När endast en viktmätning
föreligger är det stor sannolikhet för lätt
protein-energiundernäring när den
observerade vikten är minst 1 men
mindre än 2 standarddeviationer under
medelvärdet hos referenspopulationen.
159
Fysisk retardation orsakad av
undernäring
Kortvuxenhet orsakad av
nutritionsrubbning
Tillväxthämning orsakad av
nutritionsrubbning
E46
Ospecificerad proteinenergiundernäring
Malnutritio proteinica non
specificata
Malnutrition UNS
Protein-energiobalans UNS
ANDRA NÄRINGSBRISTTILLSTÅND
(E50-E64)
E51.2
Wernickes encefalopati
E51.8
Andra specificerade manifestationer
av tiaminbrist
Utesluter:
Nutritionsanemier (D50-D53)
E51.9
Tiaminbrist, ospecificerad
E50
E52
Niacinbrist [pellagra]
Alia malnutritio
A-vitaminbrist
Deficientia niacini
Deficientia vitamini A
Niacin(-tryptofan)brist
Nikotinamidbrist
Pellagra (alkoholbetingad)
Utesluter:
Sena effekter av A-vitaminbrist (E64.1)
E50.0
A-vitaminbrist med xeros i
konjunktiva
E50.1
A-vitaminbrist med Bitots fläck och
xeros i konjunktiva
Utesluter:
Sena effekter av niacinbrist (E64.8)
E53
Bitots fläck hos småbarn
Deficientia aliorum vitaminorum B
E50.2
A-vitaminbrist med xeros i kornea
E50.3
A-vitaminbrist med sår och xeros i
kornea
E50.4
A-vitaminbrist med keratomalaci
E50.5
A-vitaminbrist med nattblindhet
E50.6
A-vitaminbrist med xeroftalmiska ärr
i kornea
E50.7
Andra okulära manifestationer av Avitaminbrist
Utesluter:
Anemi orsakad av B12-brist (D51.-)
Sena effekter av B-vitaminbrist (E64.8)
Xeroftalmi UNS
E50.8
E53.0
Riboflavinbrist
E53.1
Pyridoxinbrist
E53.8
E51
Tiaminbrist
Hypovitaminos A UNS
Brist på andra specificerade
vitaminer i B-gruppen
E53.9
B-vitaminbrist, ospecificerad
E54
Askorbinsyrabrist
Deficientia acidi ascorbici
Deficientia thiamini
C-vitaminbrist
Skörbjugg
Utesluter:
Sena effekter av tiaminbrist (E64.8)
E51.1
B6-vitaminbrist
Brist på:
• biotin
• cyanokobalamin
• folat
• folsyra
• pantotensyra
• vitamin B12
Follikulär keratos orsakad av Avitaminbrist† (L86*)
Xeroderma orsakad av A-vitaminbrist†
(L86*)
A-vitaminbrist, ospecificerad
Ariboflavinos
Utesluter:
Sideroblastisk anemi som svarar på
pyridoxinbehandling (D64.3)
Andra specificerade manifestationer
av A-vitaminbrist
E50.9
Brist på andra vitaminer i Bgruppen
Utesluter:
Anemi på grund av C-vitaminbrist
(D53.2)
Sena effekter av C-vitaminbrist (E64.2)
Beriberi
Torr beriberi
Våt beriberi† (I98.8*)
160
E55
E55.0
D-vitaminbrist
E59
Dietbetingad selenbrist
Deficientia vitamini D
Deficientia seleni diaetaria
Utesluter:
Osteomalaci hos vuxen (M83.-)
Osteoporos (M80-M81)
Sena effekter av rakit (E64.3)
Utesluter:
Sena effekter av selenbrist (E64.8)
Keshan-sjuka
E60
Aktiv rakit
Infantil osteomalaci
Juvenil osteomalaci
Deficientia zinci diaetaria
Utesluter:
Rakit (vid):
• celiaki (K90.0)
• Crohns sjukdom (K50.-)
• D-vitaminresistent (E83.3)
• inaktiv (E64.3)
• renal (N25.0)
E55.9
D-vitaminbrist, ospecificerad
E56
Andra vitaminbristtillstånd
Dietbetingad zinkbrist
E61
Brist på andra grundämnen i
födan
Deficientia aliorum elementorum
nutrimenti
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
Utesluter:
Jodbristrelaterade tyreoideasjukdomar
(E00-E02)
Rubbningar i mineralmetabolismen
(E83.-)
Sena effekter av näringsbristtillstånd
(E64.-)
D-avitaminos
Deficientia aliorum vitaminorum
Utesluter:
Sena effekter av andra
vitaminbristtillstånd (E64.8)
E61.0
Kopparbrist
E56.0
E-vitaminbrist
E61.1
Järnbrist
E56.1
K-vitaminbrist
Utesluter:
Järnbristanemi (D50.-)
Utesluter:
Brist på koagulationsfaktor orsakad av
K-vitaminbrist (D68.4)
K-vitaminbrist hos nyfödd (P53)
E56.8
Brist på andra specificerade
vitaminer
E56.9
Vitaminbrist, ospecificerad
E58
Dietbetingad kalciumbrist
Deficientia calcii diaetaria
Utesluter:
Rubbningar i kalciummetabolismen
(E83.5)
Sena effekter av kalciumbrist (E64.8)
161
E61.2
Magnesiumbrist
E61.3
Manganbrist
E61.4
Krombrist
E61.5
Molybdenbrist
E61.6
Vanadiumbrist
E61.7
Brist på multipla grundämnen i födan
E61.8
Brist på andra specificerade
grundämnen i födan
E61.9
Brist på grundämne i födan,
ospecificerad
E63
Andra näringsbristtillstånd
FETMA OCH ANDRA
ÖVERNÄRINGSTILLSTÅND (E65-E68)
Aliae deficientiae nutritionales
Utesluter:
Dehydrering (E86)
Failure to thrive (R62.8)
Sena effekter av undernäring och andra
näringsbristtillstånd (E64.-)
Uppfödningsproblem hos nyfödd (P92.-)
E63.0
Brist på essentiella fettsyror [EFA]
E63.1
Obalans i beståndsdelarna i
födointaget
E63.8
Andra specificerade
näringsbristtillstånd
E63.9
Näringsbristtillstånd, ospecificerat
E64
E65
Lokaliserad fetma
Adipositas localisata
Fettkudde
E66
Fetma
Obesitas
Utesluter:
Adiposogenital dystrofi (E23.6)
Lipomatos UNS (E88.2)
Lipomatosis dolorosa [Dercum] (E88.2)
Prader-Willis syndrom (Q87.1)
Kardiomyopati vid nutritionsrubbning
UNS† (I43.2*)
Sena effekter av undernäring
och andra näringsbristtillstånd
Sequelae malnutritionis et
aliarum deficientiarum
nutritionalium
E66.0
Fetma orsakad av kaloriöverskott
E66.1
Läkemedelsutlöst fetma
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
E66.2
Anmärkning:
E64 skall inte användas för kronisk
undernäring eller näringsbrist. Sådana
tillstånd kodas som aktuell undernäring
eller näringsbrist.
E64.0
Obesitas et alia hyperalimentatio
Extrem fetma med alveolär
hypoventilation
Obesity hypoventilation syndrome
(OHS)
Pickwicksyndrom
E66.8
Annan specificerad fetma
Sena effekter av proteinenergiundernäring
E66.9
Fetma, ospecificerad
Utesluter:
Försenad utveckling efter proteinenergiundernäring (E45)
E67
Annan övernäring
E64.1
Sena effekter av A-vitaminbrist
E64.2
Sena effekter av C-vitaminbrist
E64.3
Sena effekter av rakit
Alia hyperalimentatio
Utesluter:
Sena effekter av övernäring (E68)
Övernäring UNS (R63.2)
Tilläggskod (M40.1, M41.5) kan användas
för att ange spinal deformitet
E64.8
Sena effekter av andra specificerade
näringsbristtillstånd
E64.9
Sena effekter av ospecificerat
näringsbristtillstånd
Sjuklig fetma
162
E67.0
Hypervitaminos A
E67.1
Hyperkarotenemi
E67.2
Megavitamin-B6-syndrom
E67.3
Hypervitaminos D
E67.8
Annan specificerad övernäring
E68
ÄMNESOMSÄTTNINGSSJUKDOMAR
(E70-E90)
Sena effekter av övernäring
Sequelae hyperalimentationis
Anmärkning:
E68 skall inte användas för kronisk
övernäring. Sådana tillstånd kodas som
aktuell övernäring .
Morbi metabolici
Utesluter:
Androgen resistens (E34.5)
Ehlers-Danlos syndrom (Q79.6)
Hemolytiska anemier orsakade av specifika
enzymrubbningar (D55.-)
Marfans syndrom (Q87.4)
Medfödd binjurebarkshyperplasi (E25.0)
5-alfa-reduktasbrist (E29.1)
E70
Rubbningar i omsättningen av
aromatiska aminosyror
Perturbationes metabolismi
aminoacidorum aromaticorum
163
E70.0
Klassisk fenylketonuri
E70.0A
Hyperfenylalaninemi
(fenylalaninhydroxylas-brist), total
E70.0B
Hyperfenylalaninemi
(fenylalaninhydroxylas-brist), partiell
E70.0X
Hyperfenylalaninemi
(fenylalaninhydroxylas-brist) UNS
E70.1
Andra hyperfenylalaninemier
E70.1A
Dihydropteridinbrist
E70.1B
Defekt tetrahydrobiopterinsyntes
E70.1W
Andra hyperfenylalaninemier (defekt
tetrahydrobiopterin-omsättning)
E70.2
Rubbningar i tyrosinomsättningen
E70.2A
Alkaptonuri
E70.2B
Tyrosinemi I
E70.2C
Tyrosinemi II
E70.2D
Tyrosinos
E70.2W
Andra rubbningar i tyrosinomsättningen
Fenylketonuri UNS
Alkaptonuri
Hypertyrosinemi
Okronos
Tyrosinemi
Tyrosinos
E70.2X
Hypertyrosinemi UNS
E71.1A
Hyperleucin-isoleucinemi
E70.3
Albinism
E71.1B
Isovalerisk acidemi
E71.1C
Metylmalonisk acidemi
E71.1D
Propionisk acidemi
E71.2
Rubbning i omsättningen av grenade
aminosyror, ospecificerad
E71.3
Rubbningar i fettsyraomsättningen
Chediak(-Steinbrinck)-Higashis syndrom
Cross syndrom
Hermansky-Pudlaks syndrom
Okulär albinism
Okulokutan albinism
E70.3A
Chediak(-Steinbrinck)-Higashis
syndrom
E70.3B
Cross syndrom
E70.3C
Hermansky-Pudlaks syndrom
E70.3D
Okulär albinism
E70.3E
Albinoidism
E71.3A
Carnitincykel/transportdefekter
E70.3F
Piebaldism
E71.3B
Betaoxidationsrubbningar
E70.3G
Waardenburgs syndrom
E71.3C
Acyl-co-enzym A-dehydrogenas-brist
E70.3W
Annan specificerad albinism
E71.3D
Adrenoleukodystrofi [Addison-Schilder]
E70.3X
Albinism, ospecificerad
E72
E70.8
Andra specificerade rubbningar i
omsättningen av aromatiska
aminosyror
Andra rubbningar i
omsättningen av aminosyror
Aliae perturbationes metabolismi
aminoacidorum
E70.9
Rubbning i omsättningen av
aromatiska aminosyror, ospecificerad
E71
Rubbningar i omsättningen av
grenade aminosyror och av
fettsyror
Utesluter:
Gikt (M10.-)
Patologiska fynd i blodet utan manifest
sjukdom (R70-R89)
Rubbningar i omsättning av:
• aromatiska aminosyror (E70.-)
• fettsyror (E71.3)
• grenade aminosyror (E71.0-E71.2)
• purin och pyrimidin (E79.-)
Adrenoleukodystrofi [Addison-Schilder]
Brist på muskelkarnitinpalmityltransferas
Utesluter:
Schilders sjukdom (G37.0)
Rubbningar i:
• histidinmetabolismen
• tryptofanmetabolismen
E72.0
Perturbationes metabolismi
aminoacidorum ramificatorum et
lipo-acidorum
E71.0
Maple-syrup-urine disease [MSUD]
E71.1
Andra rubbningar i omsättningen av
grenade aminosyror
Hyperleucin-isoleucinemi
Hypervalinemi
Isovalerisk acidemi
Metylmalonisk acidemi
Propionisk acidemi
164
Rubbningar i aminosyratransporten
Cysteininlagringssjukdom i njure†
(N29.8*)
Cystinos
Cystinuri
Fanconis(-de Toni)(-Debrés) syndrom
Hartnups sjukdom
Lowes syndrom
Utesluter:
Rubbningar i tryptofanomsättningen
(E70.8)
E72.0A
Cystinos
E72.0B
Cystinuri
E72.0C
Fanconi-de Toni-Debrés syndrom
E72.0W
Annan specificerad rubbning i
aminosyratransporten
E72.1
Rubbningar i omsättningen av
svavelhaltiga aminosyror
Rubbning i omsättningen av
aminosyror, ospecificerad
E73
Laktosintolerans
Intolerantia lactosi
Cystationinuri
Homocystinuri
Metioninemi
Sulfitoxidasbrist
Utesluter:
Brist på transkobalamin II (D51.2)
E72.2
E72.9
Rubbningar i urinämnesomsättningen
Argininemi
Argininobärnstenssyruri
Citrullinemi
Hyperammonemi
Utesluter:
Rubbningar i ornitinomsättningen
(E72.4)
E73.0
Medfödd laktasbrist
E73.0A
Laktasbrist, primär, medfödd
E73.0B
Laktasbrist, primär, sent debuterande
E73.1
Sekundär laktasbrist
E73.8
Annan laktosintolerans
E73.9
Laktosintolerans, ospecificerad
E74
Andra rubbningar i
kolhydratomsättningen
Aliae perturbationes metabolismi
carbohydratorum
E72.2A
Argininemi
E72.2B
Arginobärnstenssyruri
E72.2C
Citrullinemi
E72.2D
Hyperammonemi
E72.2W
Andra urinämnesomsättningsrubbningar
E72.3
Rubbningar i lysin- och
hydroxylysinomsättningen
Utesluter:
Diabetes mellitus (E10-E14)
Hypoglykemi UNS (E16.2)
Mukopolysackaridos (E76.0-E76.3)
Överproduktion av glukagon (E16.3)
E74.0
Glykogeninlagringssjukdom
E74.1
Rubbningar i fruktosomsättningen
E74.2
Rubbningar i galaktosomsättningen
E74.3
Andra specificerade rubbningar i
intestinal kolhydratresorption
Glutarsyrauri
Hydroxylysinemi
Hyperlysinemi
Utesluter:
Refsums sjukdom (G60.1)
Zellwegers syndrom (Q87.8)
E72.4
Rubbningar i ornitinomsättningen
E72.5
Rubbningar i glycinomsättningen
E72.8
Ornitinemi (typ I, II)
Hyperhydroxyprolinemi
Hyperprolinemi (typ I, II)
Icke-ketotisk hyperglycinemi
Sarkosinemi
Andra specificerade rubbningar i
omsättningen av aminosyror
Andersens sjukdom
Coris sjukdom
Forbes sjukdom
Hers sjukdom
Hjärtglykogenos
Leverfosforylasbrist
McArdles sjukdom
Pompes sjukdom
Taruis sjukdom
von Gierkes sjukdom
Essentiell fruktosuri
Fruktos-1,6-difosfatbrist
Hereditär fruktosintolerans
Galaktokinasbrist
Galaktosemi
Glukos-galaktosmalabsorption
Sukrasbrist
Rubbningar i:
• betaaminosyraomsättningen
• gammaglutamylcykeln
Utesluter:
Laktosintolerans (E73.-)
165
E74.4
Rubbningar i pyruvatomsättning och
glukoneogenes
E75.2
Brist på:
• fosfoenolpyruvatkarboxykinas
• pyruvatkarboxylas
• pyruvatdehydrogenas
Utesluter:
Anemi orsakad av enzymrubbningar
(D55.-)
E74.8
Essentiell pentosuri
Oxalos
Oxaluri
Renal glukosuri
Renal glukosuri
E74.8B
Oxaluri
E74.8W
Annan specificerad rubbning i
kolhydratomsättningen
E74.9
Rubbning i kolhydratomsättningen,
ospecificerad
E75
Rubbningar i
sfingolipidomsättningen och
andra rubbningar i
fettupplagringen
Perturbationes metabolismi
sphingolipidorum et aliae
perturbationes accumulationis
lipoidorum
E75.1
E75.2A
Gauchers sjukdom
E75.2B
Krabbes sjukdom
E75.2C
Metakromatisk leukodystrofi
E75.2D
Niemann-Picks sjukdom
E75.2E
Farbers syndrom
E75.2F
Fabry-Andersons sjukdom
E75.2W
Andra specificerade sfingolipidoser
E75.3
Sfingolipidos, ospecificerad
E75.4
Neuronal ceroid lipofuscinos
E75.5
Andra specificerade rubbningar i
fettupplagringen
Battens sjukdom
Bielschowsky-Janskys sjukdom
Kufs sjukdom
Spielmeyer-Vogts sjukdom
Cerebrotendinös kolesteros [van
Bogaert-Scherer-Epstein]
Wolmans sjukdom
Utesluter:
Mukolipidos, typ I-III (E77.0-E77.1)
Refsums sjukdom (G60.1)
E75.0
Fabrys (-Andersons) sjukdom
Farbers syndrom
Gauchers sjukdom
Krabbes sjukdom
Metakromatisk leukodystrofi
Niemann-Picks sjukdom
Sulfatasbrist
Utesluter:
Adrenoleukodystrofi [Addison-Schilder]
(E71.3)
Andra specificerade rubbningar i
kolhydratomsättningen
E74.8A
Andra specificerade sfingolipidoser
E75.6
Rubbning i fettupplagringen,
ospecificerad
E76
Rubbningar i omsättningen av
glukosaminoglykaner
GM2-gangliosidos
GM2-gangliosidos:
• hos vuxen
• juvenil
• UNS
Sandhoffs sjukdom
Tay-Sachs sjukdom
Perturbationes metabolismi
glucosaminoglycanorum
Andra gangliosidoser
Gangliosidos:
• GM1
• GM3
• UNS
Mukolipidos IV
166
E76.0
Mukopolysackaridos, typ I
E76.1
Mukopolysackaridos, typ II
Hurlers syndrom
Hurler-Scheies syndrom
Scheies syndrom
Hunters syndrom
E76.2
E78
Andra specificerade
mukopolysackaridoser
Betaglukuronidasbrist
Mukopolysackaridos, typ III, IV, VI, VII
Syndrom:
• Maroteaux-Lamy (lätt) (svår)
• Morquio (-liknande) (klassisk)
• Sanfilippo (typ B) (typ C) (typ D)
E76.2C
Maroteaux-Lamys syndrom (lätt)(svår)
E76.2D
Morquios syndrom
E76.2E
Sanfilippos syndrom (typ B) (typ C) (typ
D)
E76.2F
Slys syndrom
E76.2W
Andra specificerade
mukopolysackaridoser
E76.3
Mukopolysackaridos, ospecificerad
E76.8
Andra specificerade rubbningar i
omsättningen av
glukosaminoglykaner
E76.9
Rubbning i omsättningen av
glukosaminoglykaner, ospecificerad
E77
Rubbningar i
glykoproteinomsättningen
Perturbationes metabolismi
lipoproteini et aliae lipidaemiae
Utesluter:
Sfingolipidoser (E75.0-E75.3)
E78.0
Isolerad hyperkolesterolemi
E78.1
Isolerad hypertriglyceridemi
E78.2
Blandad hyperlipidemi
Perturbationes metabolismi
glycoproteinorum
E77.0
Post-translationell defekt i lysosomala
enzymer
Mukolipidos II [I-cellsjukdom]
Mukolipidos III [Pseudo-Hurler
polydystrofi]
E77.1
Brister i nedbrytningen av
glykoprotein
Aspartylglukosaminuri
Fukosidos
Mannosidos
Sialidos [mukolipidos I]
E77.8
Andra specificerade rubbningar i
omsättningen av glykoprotein
E77.9
Rubbning i omsättningen av
glykoprotein, ospecificerad
167
Rubbning i omsättningen av
lipoprotein och andra
lipidemier
Familjär hyperkolesterolemi
Fredrickson-typ IIa-hyperlipoproteinemi
Hyperbetalipoproteinemi
Hyperlipidemi, grupp A
Low-density-lipid-hyperlipoproteinemi
[LDL]
Endogen hypertriglyceridemi
Fredrickson-typ IV-hyperlipoproteinemi
Hyperlipidemi, grupp B
Hyperprebetalipoproteinemi
Very-low-density-lipidhyperlipoproteinemi [VLDL]
Bred eller flytande betalipoproteinemi
Fredrickson-typ IIb eller IIIhyperlipoproteinemi
Hyperbetalipoproteinemi med
prebetalipoproteinemi
Hyperkolesterolemi med endogen
hyperglyceridemi
Hyperlipidemi, grupp C
Tuberoeruptivt xantom
Xanthoma tuberosum
Utesluter:
Cerebrotendinös kolesteros [van
Bogaert-Scherer-Epstein] (E75.5)
E78.2F
Tuberoeruptivt xantom
E78.2G
Xanthoma tuberosum
E78.2H
Xanthoma tendinosum
E78.2J
Xanthoma disseminatum
E78.2K
Plana xantom
E78.2L
Generaliserad plan xantomatos
E78.2X
Blandad hyperlipidemi, ospecificerad
E78.3
E80
Hyperkylomikronemi
Fredrickson-typ I eller Vhyperlipoproteinemi
Hyperlipidemi, grupp D
Blandad hyperglyceridemi
Rubbningar i omsättningen av
porfyrin och bilirubin
Perturbationes metabolismi
porphyrini et bilirubini
E78.4
Andra specificerade hyperlipidemier
E78.5
Hyperlipidemi, ospecificerad
E78.6
Lipoproteinbrist
Innefattar:
Brist på katalas och peroxidas
Familjär kombinerad hyperlipidemi
Abetalipoproteinemi
High-density-lipoproteinbrist
Hypo-alfalipoproteinemi
Hypo-betalipoproteinemi (familjär)
Lecitin-kolesterol-acyltransferasbrist
Tangier-sjuka
E80.0
Hereditär erytropoetisk porfyri
E80.0A
Erytropoetisk protoporfyri
E80.0B
Kongenital erytropoetisk porfyri
E80.0C
Erytropoetisk koproporfyri
Erytropoetisk protoporfyri
Kongenital erytropoetisk porfyri
E78.8
Andra specificerade rubbningar i
omsättningen av lipoprotein
E80.0W
Annan och ospecificerad hereditär
erytropoetisk porfyri
E78.9
Rubbning i omsättningen av
lipoprotein, ospecificerad
E80.1
Porphyria cutanea tarda
E80.2
Annan porfyri
E79
Rubbningar i purin- och
pyrimidinomsättningen
Akut intermittent (hepatisk) porfyri
Hereditär koproporfyri
Porfyri UNS
Perturbationes metabolismi purini
et pyrimidini
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
Utesluter:
Gikt (M10.-)
Kombinerade immunbristtillstånd
(D81.-)
Njursten (N20.0)
Orotacidurisk anemi (D53.0)
Xeroderma pigmentosum (Q82.1)
E79.0
Hyperurikemi utan tecken på
inflammatorisk artrit och tofös
sjukdom
Asymtomatisk hyperurikemi
E80.2A
Akut intermittent porfyri (hepatisk)
E80.2B
Hereditär koproporfyri
E80.2C
Hepatoerytropoetisk porfyri
E80.2D
Porphyria variegata
E80.2W
Annan specificerad porfyri
E80.2X
Porfyri, ospecificerad
E80.3
Brist på katalas och peroxidas
E79.1
Lesch-Nyhans syndrom
E79.8
Andra specificerade rubbningar i
purin- och pyrimidinomsättningen
E80.4
Gilberts syndrom
E80.5
Crigler-Najjars syndrom
Rubbning i purin- och pyrimidinomsättningen, ospecificerad
E80.5A
Crigler-Najjars syndrom, typ 1
E80.5B
Crigler-Najjars syndrom, typ 2
E80.6
Andra specificerade rubbningar i
bilirubinomsättningen
Hereditär xantinuri
E79.9
Acatalasia [Takahara]
Dubin-Johnsons syndrom
Rotors syndrom
168
E80.7
E83
Rubbning i bilirubinomsättningen,
ospecificerad
E83.4
Hypermagnesemi
Hypomagnesemi
Rubbningar i
mineralomsättningen
E83.5
Perturbationes metabolismi
mineralium
E83.0
Rubbningar i
magnesiumomsättningen
Rubbningar i kalciumomsättningen
Familjär hypokalciurisk hyperkalcemi
Idiopatisk hyperkalciuri
Utesluter:
Hyperparatyreoidism (E21.0-E21.3)
Kondrokalcinos (M11.1-M11.2)
Utesluter:
Dietbetingad mineralbrist (E58-E61)
Paratyreoideasjukdomar (E20-E21)
D-vitaminbrist (E55.-)
E83.5C
Calcinosis universalis
Rubbningar i kopparomsättningen
E83.5D
Metastatisk förkalkning
E83.5E
Tumoral kalcinos
E83.5X
Rubbning i kalciumomsättningen,
ospecificerad
E83.8
Andra specificerade rubbningar i
mineralomsättningen
E83.9
Rubbning i mineralomsättningen,
ospecificerad
E84
Cystisk fibros
Menkes sjukdom
Wilsons sjukdom
E83.0A
Menkes sjukdom
E83.0B
Wilsons sjukdom
E83.0W
Andra rubbningar i kopparomsättningen
E83.1
Rubbningar i järnomsättningen
Hemokromatos
Utesluter:
Järnbristanemi (D50.-)
Sideroblastisk anemi (D64.0-D64.3)
Fibrosis cystica
E83.2
Rubbningar i zinkomsättningen
E83.3A
Minskad syntes av 1,2,5-dihydroxyvitamin D3
E84.0
E83.3B
Receptordefekter X-bunden
hypofosfatemisk rakit
Cystisk fibros med
lungmanifestationer
E84.1
E83.3C
Hypofosfatemisk X-bunden rakit
Cystisk fibros med intestinala
manifestationer
E83.3D
D-vitaminresistent osteomalaci
E83.3W
Annan specificerad rubbning i
fosforomsättningen
E83.3
Rubbningar av fosforomsättningen
och fosfataser
Acrodermatitis enteropathica
Innefattar:
Mukoviskidos
Distalt intestinalt obstruktionssyndrom
Mekoniumileus vid cystisk fibros†
(P75*)
Utesluter:
Mekoniumobstruktion (ileus) i fall där
cystisk fibros inte förekommer (P76.0)
Brist på sura fosfataser
D-vitaminresistent:
• osteomalaci
• rakit
Familjär hypofosfatemi
Hypofosfatasi
Utesluter:
Osteomalaci hos vuxen (M83.-)
Osteoporos (M80-M81)
169
E84.8
Cystisk fibros med andra
manifestationer
E84.9
Cystisk fibros, ospecificerad
E85
E85.0
Amyloidos
E87.0A
Hyperosmolalit
Amyloidosis
E87.0B
Hypernatremi
Utesluter:
Alzheimers sjukdom (G30.-)
E87.1
Hyposmolalitet och hyponatremi
Icke-neuropatisk heredofamiljär
amyloidos
Utesluter:
Abnorm sekretion av antidiuretiskt
hormon (E22.2)
Familjär medelhavsfeber
Hereditär amyloidnefropati
E85.1
Neuropatisk heredofamiljär
amyloidos
Amyloid polyneuropati
Skelleftesjukan
E85.2
Heredofamiljär amyloidos,
ospecificerad
E85.3
Sekundär systemamyloidos
E85.4
Organbegränsad amyloidos
E85.8
Annan amyloidos
E85.8A
AL-amyloidos
E85.8W
Annan specificerad amyloidos än E85.0E85.4
E86
Minskad vätskevolym
Depletio voluminis
Dehydrering
Hypovolemi
Reduktion av plasmavolym eller
extracellulärvätska
E87.1B
Hyponatremi
E87.2
Acidos
Acidos UNS
Metabolisk acidos
Mjölksyracidos
Respiratorisk acidos
E87.3
Alkalos
E87.4
Blandad syra-basbalansrubbning
E87.5
Hyperkalemi
E87.6
Hypokalemi
E87.7
Ökad vätskevolym
Alkalos UNS
Metabolisk alkalos
Respiratorisk alkalos
Kalium-[K]-överskott
Kalium-[K]-brist
Utesluter:
Ödem (R60.-)
E87.8
Utesluter:
Dehydrering hos nyfödd (P74.1)
Hypovolemisk chock:
• postoperativ (T81.1)
• traumatisk (T79.4)
• UNS (R57.1)
Andra elektrolyt- och
vätskerubbningar som ej klassificeras
på annan plats
Elektrolytrubbning UNS
Hyperkloremi
Hypokloremi
E88
Andra rubbningar i vätske-,
elektrolyt- och syrabasbalans
Andra
ämnesomsättningssjukdomar
Aliae perturbationes metabolicae
Aliae perturbationes aequilibrii
humoralis, electrolytici et
acidoalkalici
E87.0
Hyposmolalitet
Utesluter:
Diabetesacidos (E10-E14 med
gemensam fjärdeposition .1)
Lokaliserad amyloidos
Amyloidos, ospecificerad
E87
E87.1A
Hemodialysassocierad amyloidos
E85.9
Natrium-[Na]-brist
Tilläggskod kan användas för att ange
orsakande läkemedel om
läkemedelsutlöst (kapitel 20)
Hyperosmolalitet och hypernatremi
Utesluter:
Histiocytos X (kronisk) (C96.6)
Natrium-[Na]-överskott
170
E88.0
Rubbningar i
plasmaproteinomsättningen som ej
klassificeras på annan plats
Alfa-1-antitrypsinbrist
Bisalbuminemi
Utesluter:
Monoklonal gammopati av obestämd
signifikans [MGUS] (D47.2)
Polyklonal hypergammaglobulinemi
(D89.0)
Rubbning i lipoproteinomsättningen
(E78.-)
Waldenströms makroglobulinemi
(C88.0)
E88.3
Tumörlyssyndrom
E88.8
Andra specificerade
ämnesomsättningssjukdomar
Tumörlys (efter antineoplastisk
läkemedelsbehandling) (spontan)
Launois-Bensaudes adenolipomatos
Trimetylaminuri
E88.0A
Alfa-1-antitrypsinbrist, asymtomatisk
E88.0B
Alfa-1-antitrypsinbrist, symtomatisk
E88.0W
Annan specificerad rubbning i plasmaproteinomsättningen som ej klassificeras
på annan plats
E88.1
Lipodystrofi som ej klassificeras på
annan plats
E88.8A
Perioxysomala sjukdomar
E88.8W
Andra specificerade ämnesomsättningsrubbningar
E88.9
Ämnesomsättningssjukdom,
ospecificerad
E89
Endokrina rubbningar och
ämnesomsättningssjukdomar
efter kirurgiska och medicinska
ingrepp som ej klassificeras på
annan plats
Perturbationes endocrinae et
metabolicae post interventiones
non alibi classificatae
Lipodystrofi UNS
Utesluter:
Whipples sjukdom (K90.8)
E89.0
E88.1A
Lipodystrophia progressiva [BarraquerSimons]
E88.1B
Lipodystrophia centrifugalis
abdominalis infantilis
E88.1C
Lipoatrophia semicircularis
E88.1D
Hypotyreos efter kirurgiska och
medicinska ingrepp
Hypotyreos efter strålning
Postoperativ hypotyreos
E89.0A
Hypotyreos efter kirurgisk terapi
E89.0B
Hypotyreos efter terapi med radioaktivt
jod
Lokaliserad fettatrofi
E89.0X
Hypotyreos efter terapi UNS
E88.1W
Annan lipodystrofi som ej klassificeras
på annan plats
E89.1
Hypoinsulinism efter kirurgiska och
medicinska ingrepp
E88.2
Lipomatos som ej klassificeras på
annan plats
Hyperglykemi efter pankreatektomi
Postoperativ hypoinsulinemi
Lipomatosis dolorosa [Dercum]
Lipomatos UNS
E88.2A
Lipomatosis dolorosa [Dercum]
E88.2B
Naevus lipomatodes superficialis
[Hoffmann-Zurhelle]
E88.2W
E89.2
Hypoparatyreoidism efter kirurgiska
och medicinska ingrepp
Kramper beroende på bristande
paratyreoideafunktion
Paratyreopriv tetani
E89.3
Annan lipomatos som ej klassificeras på
annan plats
171
Hypopituitarism efter kirurgiska och
medicinska ingrepp
Hypopituitarism efter strålning
E89.4
Ovarial svikt efter kirurgiska och
medicinska ingrepp
E89.5
Testikulär hypofunktion efter
kirurgiska och medicinska ingrepp
E89.6
Binjurehypofunktion efter kirurgiska
och medicinska ingrepp
E89.8
Andra specificerade endokrina
rubbningar och ämnesomsättningssjukdomar efter
kirurgiska och medicinska ingrepp
E89.9
Endokrina rubbningar och
ämnesomsättningssjukdomar efter
kirurgiska och medicinska ingrepp,
ospecificerade
E90*
Rubbningar i nutrition och
ämnesomsättning vid
sjukdomar som klassificeras
på annan plats
Perturbationes nutritionales et
metabolicae in morbis alibi
classificatis
172
Kapitel 5
Psykiska sjukdomar och syndrom
samt beteendestörningar
(F00-F99)
Morbi et syndromata mentis et perturbationes
morum
Innefattar:
Störningar i psykisk utveckling
Utesluter:
Symtom, sjukdomstecken och onormala kliniska fynd och laboratoriefynd som ej klassificeras på
annan plats (R00-R99)
Detta kapitel innehåller följande avsnitt:
F00-F09 Organiska, inklusive symtomatiska, psykiska störningar
F10-F19 Psykiska störningar och beteendestörningar orsakade av psykoaktiva substanser
F20-F29 Schizofreni, schizotypa störningar och vanföreställningssyndrom
F30-F39 Förstämningssyndrom
F40-F48 Neurotiska, stressrelaterade och somatoforma syndrom
F50-F59 Beteendestörningar förenade med fysiologiska rubbningar och fysiska faktorer
F60-F69 Personlighetsstörningar och beteendestörningar hos vuxna
F70-F79 Psykisk utvecklingsstörning
F80-F89 Störningar i psykisk utveckling
F90-F98 Beteendestörningar och emotionella störningar med debut vanligen under barndom och
ungdomstid
F99
Ospecificerad psykisk störning
Detta kapitel innehåller följande asteriskkoder:
F00* Demens vid Alzheimers sjukdom
F02* Demens vid andra sjukdomar som klassificeras på annan plats
173
ORGANISKA, INKLUSIVE
SYMTOMATISKA, PSYKISKA
STÖRNINGAR (F00-F09)
F00.0*
Demens vid Alzheimers sjukdom med
tidig debut (G30.0†)
Demens vid Alzheimers sjukdom med debut
före 65 års ålder, med relativt snabbt
progredierande försämring och med
multipla uttalade störningar av högre
kortikala funktioner.
Alzheimers sjukdom, typ 2
Presenil demens av Alzheimertyp
Primär degenerativ demens av
Alzheimertyp, presenil debut
Perturbationes mentis organicae et
symptomaticae
Detta avsnitt omfattar en grupp organiska syndrom
med psykiska symtom som alla har en påvisbar
etiologi såsom hjärnsjukdom, hjärntrauma eller annan
skada som leder till cerebral dysfunktion.
Dysfunktionen kan vara primär, som vid sjukdom,
trauma eller annan skada som påverkar hjärnan direkt
och selektivt, eller sekundär, som vid
systemsjukdomar och liknande tillstånd där hjärnan
angrips tillsammans med andra organ eller
organsystem.
F00.1*
Demens (F00-F03) är ett syndrom som beror på
hjärnsjukdom som vanligtvis är av kronisk eller
progredierande art. De högre kortikala funktionerna,
inkluderande minne, tänkande, orientering, förståelse,
räkneförmåga, inlärningskapacitet, språk och
omdöme är störda. Medvetandet är inte grumlat.
Försämringen av kognitiva funktioner åtföljs ofta,
och är ibland föregången av, försämring av
emotionell kontroll, socialt beteende eller motivation.
Detta syndrom förekommer vid Alzheimers sjukdom,
vid cerebrovaskulär sjukdom och vid andra tillstånd
som primärt eller sekundärt påverkar hjärnan.
F00.2*
F00.9*
Demens vid Alzheimers sjukdom,
ospecificerad (G30.9†)
Tilläggskod kan användas för att ange underliggande
sjukdom.
F01
Vaskulär demens
Demens vid Alzheimers sjukdom med
sen debut (G30.1†)
Demens vid Alzheimers sjukdom med debut
efter 65 års ålder, oftast omkring 80 år eller
senare. Progressen är långsam och det
främsta kännetecknet är minnesstörningar.
Alzheimers sjukdom, typ 1
Primär degenerativ demens av
Alzheimertyp, senil debut
Senil demens av Alzheimertyp
Demens vid Alzheimers sjukdom,
atypisk eller blandad typ (G30.8†)
Atypisk demens av Alzheimertyp
Dementia vascularis
F00*
Vaskulär demens är ett resultat av infarkter i
hjärnan beroende på vaskulär sjukdom,
inklusive hypertensiv cerebrovaskulär
sjukdom. Infarkterna är vanligen små men
effekten är kumulativ. Sjukdomsdebuten
kommer vanligtvis sent i livet.
Demens vid Alzheimers
sjukdom
Dementia in morbo Alzheimer
Alzheimers sjukdom är en primär,
degenerativ cerebral sjukdom av okänd
etiologi med karakteristiska
neuropatologiska och neurokemiska
kännetecken. Sjukdomsdebuten är ofta
smygande och sjukdomen progredierar
sakta men jämnt under åtskilliga år.
Innefattar:
Arteriosklerotisk demens
F01.0
Vaskulär demens med akut debut
Utvecklas vanligtvis snabbt som följd av
upprepade cerebrovaskulära tromboser,
embolier eller blödningar. I sällsynta fall är
orsaken en enstaka, stor infarkt.
F01.1
Multiinfarktdemens
Gradvis sjukdomsdebut efter ett antal
övergående ischemiska episoder, vilka
tillsammans ger en ackumulation av
infarkter i det cerebrala parenkymet.
Huvudsakligen kortikal demens
174
F01.2
Subkortikal vaskulär demens
F02.2*
Inkluderar fall med hypertonianamnes och
foci av ischemiska skador i den djupa, vita
substansen i de cerebrala hemisfärerna.
Hjärnbarken är ofta oskadad, vilket står i
kontrast till den kliniska bilden, som kan
likna en demens vid Alzheimers sjukdom.
F01.3
Blandad kortikal och subkortikal
vaskulär demens
F01.8
Annan specificerad vaskulär demens
F01.9
Vaskulär demens, ospecificerad
F02*
Demens vid andra sjukdomar
som klassificeras på annan
plats
Ett demenstillstånd som är ett delsymtom i
en omfattande cerebral degeneration.
Sjukdomen nedärvs genom en autosomal,
dominant gen. Symtomen debuterar mellan
30 och 50 års ålder. Sjukdomen
progredierar långsamt och leder till döden
inom 10-15 år.
Demens vid Huntingtons korea
F02.3*
F02.4*
Demenser som är eller kan antas vara
orsakade av andra tillstånd än Alzheimers
sjukdom eller cerebrovaskulär sjukdom.
Sjukdom kan debutera när som helst under
livet, dock sällan vid hög ålder.
Demens vid Picks sjukdom (G31.0†)
En progredierande demens som börjar i
medelåldern och karakteriseras av tidiga,
sakta progredierande karaktärsförändringar
och försämrade sociala färdigheter, följt av
försämrade intellektuella och språkliga
funktioner samt försämrat minne med apati
och eufori och ibland extrapyramidala
fenomen.
F02.1*
Demens vid Parkinsons sjukdom
(G20†)
Ett demenstillstånd som kan förekomma i
förloppet av Parkinsons sjukdom. Inga
särskilda kliniska tecken har kunnat påvisas
som skiljer detta demenstillstånd från andra
demenser.
Demens vid paralysis agitans
Dementia in aliis morbis, alibi
classificatis
F02.0*
Demens vid Huntingtons sjukdom
(G10†)
Demens vid Creutzfeldt-Jakobs
sjukdom (A81.0†)
En progredierande demens med omfattande
neurologiska symtom, orsakad av specifika
neuropatologiska förändringar som antas
vara förorsakade av ett virus.
Sjukdomsdebut inträffar vanligtvis i
medelåldern eller senare i livet men kan ske
när som helst i vuxen ålder. Förloppet är
subakut och leder till döden inom loppet av
ett till två år.
175
Demens vid sjukdom orsakad av
humant immunbristvirus [HIV]
(B22.0†)
En demens som utvecklar sig i förloppet av
HIV-sjukdom, då andra samtidiga
sjukdomar eller tillstånd som kan förklara
den kliniska bilden saknas.
F02.8*
Demens vid andra specificerade
sjukdomar som klassificeras på annan
plats
Demens vid:
• cerebral lipidos (E75.-†)
• epilepsi (G40.-†)
• förgiftningar (T36-T65†)
• hepatolentikulär degeneration
(E83.0†)
• hyperkalcemi (E83.5†)
• hypotyreos, förvärvad (E01.-†,
E03.-†)
• lewykropp(s) (sjukdom) (G31.8†)
• multipel skleros (G35†)
• neurosyfilis (A52.1†)
• niacinbrist [pellagra] (E52†)
• polyarteritis nodosa (M30.0†)
• systemisk lupus erythematosus
(M32.-†)
• trypanosomiasis (B56.-†, B57.-†)
• uremi (N18.5†)
• vitamin B12-brist (E53.8†)
F03
Ospecificerad demens
F05
Dementia non specificata
Presenil demens UNS
Presenil psykos UNS
Primär degenerativ demens UNS
Senil demens med depressiv eller
paranoid reaktion
Senil demens UNS
Senil psykos UNS
Delirium, ab alcohol sive aliis
substantiis psychoactivis non
provocatum
Ett etiologiskt ospecifikt, organiskt cerebralt
syndrom som karakteriseras av samtidigt
uppträdande störningar av medvetande,
uppmärksamhet, uppfattningsförmåga,
tänkande, minne, psykomotorisk funktion,
emotioner och sömn-vakenhet. Syndromets
varaktighet växlar och svårighetsgraden
varierar från mild till mycket uttalad.
Tilläggskod kan användas för att ange
delirium eller akut konfusion med
underliggande demenssjukdom
Utesluter:
Senilitet UNS (R54)
F04
Delirium ej framkallat av
alkohol eller andra psykoaktiva
substanser
Innefattar:
Akut eller subakut:
• hjärnsyndrom
• infektiös psykos
• konfusion (ej alkoholutlöst)
• organisk reaktion
• psykoorganiskt syndrom
Organiska amnesisyndrom ej
framkallade av alkohol eller
andra psykoaktiva substanser
Syndroma amnesiae organicum,
ab alcohol sive aliis substantiis
psychoactivis non provocatum.
Syndrom med markant störning av korttidsoch långtidsminne men där omedelbar
hågkomst är intakt. Inlärningsförmågan med
avseende på nytt material är reducerad och
det föreligger desorientering till tid.
Konfabulation kan vara ett framträdande
drag men perception och andra kognitiva
funktioner, inklusive intellekt, är vanligtvis
intakta. Prognosen är beroende på
bakomliggande skada.
Korsakoffs psykos eller syndrom, ej
alkoholutlöst
Utesluter:
Amnesi UNS (R41.3)
Anterograd amnesi (R41.1)
Dissociativ amnesi (F44.0)
Retrograd amnesi (R41.2)
Korsakoffs syndrom:
• alkoholutlöst eller ospecificerat
(F10.6)
• framkallat av andra psykoaktiva
substanser (F11-F19 med gemensam
fjärdeposition .6)
176
Utesluter:
Delirium tremens, alkoholutlöst eller
ospecificerat (F10.4)
F05.0
Delirium utan underliggande
demenssjukdom
F05.1
Delirium med underliggande
demenssjukdom
Tilläggskod kan användas för att ange typ av
demenssjukdom
F05.8
Annat specificerat delirium
F05.9
Delirium, ospecificerat
Delirium med blandad etiologi
Postoperativt delirium
F06
Andra psykiska störningar
orsakade av hjärnskada,
cerebral dysfunktion eller
kroppslig sjukdom
F06.2
En störning där ständiga eller
återkommande vanföreställningar
dominerar den kliniska bilden.
Vanföreställningarna kan vara åtföljda av
hallucinationer. Schizofreniliknande drag,
såsom bisarra hallucinationer eller
tankestörningar, kan förekomma.
Paranoida och paranoid-hallucinatoriska
organiska tillstånd
Schizofreniliknande psykos vid epilepsi
Aliae perturbationes mentis, a
laesione cerebri, dysfunctione
cerebri sive morbo somatico
provocatae
Denna kategori innefattar olika tillstånd
förknippade med störda hjärnfunktioner som
orsakas av primär hjärnsjukdom,
systemsjukdomar som sekundärt påverkar
hjärnan, exogena toxiska substanser eller
hormoner, endokrina sjukdomar eller andra
somatiska sjukdomar.
Utesluter:
Psykiska störningar:
• förenade med delirium (F05.-)
• förenade med demens som
klassificeras under (F00-F03)
• orsakade av användning av alkohol
och andra psykoaktiva substanser
(F10-F19)
F06.0
Organiskt förstämningssyndrom
Syndrom som karakteriseras av en
förändring i grundstämning eller affekt,
vanligtvis åtföljd av en förändring i
aktivitetsnivå. Syndromen kan vara
depressiva, hypomana, maniska eller
bipolära (se F30-F38) men har uppstått till
följd av en organisk störning.
Organisk hallucinos
Utesluter:
Affektiva syndrom, icke organiska eller
ospecificerade (F30-F39)
F06.4
Organiskt ångestsyndrom
Syndrom som karakteriseras av de drag som
är beskrivna för generaliserat
ångestsyndrom (F41.1), paniksyndrom
(F41.0) eller en kombination av båda, men
som orsakas av en organisk sjukdom.
Utesluter:
Ångesttillstånd, icke organiskt eller
ospecificerat (F41.-)
Utesluter:
Alkoholhallucinos (F10.5)
Schizofreni (F20.-)
F06.1
Utesluter:
Akut och övergående psykotiskt
syndrom (F23.-)
Drogutlöst psykotisk störning (F11-F19
med gemensam fjärdeposition .5)
Kroniskt vanföreställningssyndrom
(F22.-)
Schizofreni (F20.-)
F06.3
En störning med ständiga eller
återkommande hallucinationer, vanligtvis
syn- eller hörselhallucinationer, som
förekommer vid klart medvetande och som
ibland kan identifieras som hallucinationer
av den drabbade, ibland inte. Paranoid
tolkning av hallucinationerna kan
förekomma men vanföreställningar
dominerar inte den kliniska bilden.
Sjukdomsinsikt kan vara bevarad.
Organiskt hallucinatoriskt tillstånd (ej
alkoholutlöst)
Organiskt vanföreställningssyndrom
Organisk katatoni
En störning med minskad (stupor) eller ökad
(excitation) psykomotorisk aktivitet med
katatona symtom. De psykomotoriska
störningarna kan växla mellan stupor och
excitation.
Utesluter:
Dissociativ stupor (F44.2)
Kataton schizofreni (F20.2)
Stupor UNS (R40.1)
177
F06.5
Organiska dissociativa syndrom
F06.9
Syndrom som karakteriseras av en partiell
eller total förlust av den normala
integrationen mellan minnen från det
förflutna, egen identitet, omedelbara
sinnesintryck och kontroll över
psykomotorisk aktivitet (se F44.-).
Tillståndet skall ha uppstått till följd av en
organisk sjukdom.
Organiskt hjärnsyndrom UNS
Organisk psykisk störning UNS
F07
Utesluter:
Dissociativa [konversions-] syndrom,
icke organiska eller ospecificerade
(F44.-)
F06.6
Förändring av personlighet och beteende
som kan åtfölja eller efterfölja sjukdom,
skada eller dysfunktion av hjärnan.
F07.0
F06.8
Lindrig kognitiv störning
Andra specificerade psykiska
syndrom och störningar orsakade av
hjärnskada, cerebral dysfunktion
eller kroppslig sjukdom
Psykos UNS utlöst av epileptiskt anfall
178
Organisk personlighetsstörning
En störning som karakteriseras av en tydlig
förändring av det premorbida beteendet med
hänsyn till emotioner, behov och impulser.
Försämrad kognitiv förmåga, försämrad
tankeförmåga och förändrat sexuellt
beteende kan också vara en del av den
kliniska bilden.
Organisk pseudopsykopatisk
personlighet
Organisk pseudoretarderad personlighet
Syndrom:
• frontallobs• limbiskt epileptiskt personlighets• lobotomi• postleukotomi-
Utesluter:
Somatoforma störningar, icke organiska
eller ospecificerade (F45.-)
En störning karakteriserad av försämrade
minnesfunktioner, inlärningssvårigheter
samt en oförmåga att koncentrera sig annat
än korta stunder. Det finns ofta en uttalad
känsla av psykisk uttröttbarhet och
nyinlärning upplevs subjektivt som svår även
om den objektivt varit god. Inga av dessa
symtom är så uttalade att diagnosen demens
(F00- F03) eller delirium (F05.-) kan sättas.
Ovanstående diagnos skall endast sättas vid
samtidig närvaro av en specifik kroppslig
sjukdom och skall inte användas vid någon
av de psykiska störningar eller
beteendestörningar som klassificeras under
F10-F99. Tillståndet kan föregå, åtfölja
eller efterfölja ett stort antal infektioner och
kroppsliga sjukdomar, både cerebrala och
systemiska. Direkta bevis på cerebralt
engagemang behöver inte föreligga.
Störningen kan skiljas från postkontusionellt
syndrom och posttraumatiskt cerebralt
syndrom (F07.2) genom annan etiologi,
färre och mildare symtom och vanligtvis
kortare varaktighet.
Personlighets- och
beteendestörningar orsakade
av hjärnsjukdom, hjärnskada
eller cerebral dysfunktion
Perturbationes personalitatis et
morum, a morbo cerebri, laesione
cerebri sive dysfunctione cerebri
provocatae
Organisk emotionell labilitet [asteni]
En störning karakteriserad av emotionell
inkontinens eller labilitet, ökad uttröttbarhet
och en mängd obehagliga kroppsliga
sensationer (t ex svimningskänslor) och
smärtor. Tillståndet har uppstått till följd av
en organisk sjukdom.
F06.7
Psykisk störning, ospecificerad,
orsakad av hjärnskada, cerebral
dysfunktion eller kroppslig sjukdom
Utesluter:
Postencefalitiskt syndrom (F07.1)
Postkontusionellt syndrom (F07.2)
Specifika personlighetsstörningar (F60.-)
Varaktig personlighetsförändring efter:
• katastrofupplevelse (F62.0)
• psykisk sjukdom (F62.1)
F07.1
Postencefalitiskt syndrom
Ospecifik och varierande
beteendeförändring i efterförloppet av
endera viral eller bakteriell encefalit. Den
principiella skillnaden mellan
postencefalitiskt syndrom och organisk
personlighetsstörning är att det
postencefalitiska syndromet är reversibelt.
Utesluter:
Organisk personlighetsstörning (F07.0)
F07.2
Postkontusionellt syndrom
Detta syndrom uppträder efter skalltrauma
(oftast så allvarligt trauma att det orsakat
medvetslöshet) och uppvisar en blandad
symtombild som kan innefatta huvudvärk,
yrsel, trötthet, irritabilitet,
koncentrationssvårigheter, svårigheter att
utföra intellektuella uppgifter,
minnesstörningar, sömnlöshet och nedsatt
tolerans för stress, emotionella upplevelser
eller alkohol.
Postkommotionellt syndrom
(encefalopati)
Posttraumatiskt hjärnsyndrom, icke
psykotiskt
Utesluter:
Aktuell hjärnskakning (S06.0)
F07.8
Andra specificerade organiska
personlighets- och beteendestörningar
orsakade av hjärnsjukdom,
hjärnskada eller cerebral dysfunktion
Organiskt affektivt syndrom utgående
från höger hemisfär
F07.9
Organisk personlighets- och
beteendestörning, ospecificerad,
orsakad av hjärnsjukdom,
hjärnskada eller cerebral dysfunktion
Organiskt psykosyndrom
F09
Ospecificerad organisk eller
symtomatisk psykisk störning
Perturbatio mentis organica sive
symptomatica non specificata
Organisk psykos UNS
Symtomatisk psykos UNS
Utesluter:
Psykos UNS (F29)
PSYKISKA STÖRNINGAR OCH
BETEENDESTÖRNINGAR ORSAKADE
AV PSYKOAKTIVA SUBSTANSER
(F10-F19)
Perturbationes mentis et morum a
substantiis psychoactivis provocatae
Detta avsnitt innehåller en mängd olika störningar med
varierande svårighetsgrad och varierande klinisk bild
som alla kan hänföras till bruk av en eller flera
psykoaktiva substanser, förskrivna av läkare eller ej. Den
aktuella psykoaktiva substansen identifieras av siffran i
tredje positionen och det kliniska tillståndet anges av en
siffra i fjärde positionen. En kod i fjärde positionen bör
användas tillsammans med varje specificerad substans
men det bör observeras att alla de koder som är avsedda
för användning i fjärde positionen inte kan kombineras
med alla substanser.
Identifikation av den psykoaktiva substansen skall
baseras på information från så många källor som möjligt.
Här ingår anamnes, analys av blod och andra
kroppsvätskor, karakteristiska fysiska och psykiska
symtom, kliniska tecken och kliniskt beteende samt
andra bevis som innehav av droger eller information från
tredje part. Många missbrukare av psykoaktiva
substanser tar mer än ett preparat. Huvuddiagnosen skall,
när det är möjligt, klassificeras efter den substans eller
substansgrupp som förorsakar eller bidrar mest till det
kliniska syndromet. Andra diagnoser skall kodas när
andra psykoaktiva substanser har tagits i sådan
omfattning att intoxikation föreligger (.0 i fjärde
positionen) eller i sådan omfattning att de förorsakat
skada (.1 i fjärde positionen), beroende (.2 i fjärde
positionen) eller andra tillstånd (.3-.9 i fjärde positionen).
Bara då missbruksmönstret varit kaotiskt eller helt
urskiljningslöst eller då verkningarna av de olika
substanserna inte går att skilja från varandra bör
diagnosen Störningar orsakade av flera droger i
kombination (F19.-) användas.
Utesluter:
Intoxikation i betydelsen förgiftning (T36-T50)
Missbruk av icke beroendeframkallande substanser
(F55)
179
Följande fjärdepositioner används för kategorierna
F10-F19:
.3 Abstinens
.0 Akut intoxikation
Ett tillstånd som följer tillförsel av en psykoaktiv
substans och resulterar i störningar av
medvetandegrad, kognition, perception, affekter eller
beteende, eller andra psykologiska funktioner.
Störningarna är direkt relaterade till substansens
akuta farmakologiska effekter och går över med tiden
med fullständig återhämtning utom i de fall då det
uppstått vävnadsskada eller andra komplikationer.
Komplikationerna kan inkludera trauma, inhalation
av kräkningar, delirium, koma, kramper och andra
medicinska komplikationer. Komplikationerna är
beroende av substansens farmakologiska klass och
administrationssätt.
Akut berusning vid alkoholism
Extas och besatthet vid intoxikation av
psykoaktiva substanser
Fylleri UNS
Patologiskt rus
”Snedtändning”
.1 Skadligt bruk
Bruk av psykoaktiva substanser på ett sätt som
skadar hälsan. Skadan kan vara fysisk (som hepatit
vid intravenöst missbruk av psykoaktiva substanser)
eller psykisk (som depressionsperioder sekundärt till
hög alkoholkonsumtion).
Missbruk av psykoaktiva substanser
.2 Beroendesyndrom
En grupp kognitiva och psykologiska fenomen samt
beteendefenomen som utvecklas efter återkommande
substansanvändning och som i typiska fall innefattar
en stark längtan efter droger, svårigheter att
kontrollera intaget, fortsatt användning trots
skadliga effekter, prioritering av substansanvändning
högre än andra aktiviteter och förpliktelser, ökad
tolerans och ibland fysiska abstinenssymtom.
Beroendesyndromet kan gälla en specifik psykoaktiv
substans (som exempelvis tobak, alkohol eller
diazepam), en klass av substanser (som exempelvis
opioider) eller flera farmakologiskt olika psykoaktiva
substanser.
Dipsomani
Kronisk alkoholism
Narkomani
180
En grupp symtom i varierande kombinationer och
med skiftande allvarlighetsgrad som förekommer då
psykoaktiva substanser helt eller delvis utsätts eller
vid ihållande bruk. Abstinensperiodens debut och
duration är tidsbegränsad och beror på typ av
psykoaktiv substans samt vilka doser som använts
före utsättning eller dosreduktion. Abstinensen kan
kompliceras av kramper
.4 Abstinens med delirium
Ett tillstånd där abstinensen, som definieras under
subkategori .3, kompliceras av delirium enligt F05.
Abstinenskramper kan också förekomma. När
organiska faktorer också bedöms ha etiologisk
betydelse skall tillståndet klassificeras under F05.8.
Delirium tremens (alkoholutlöst)
.5 Psykotisk störning
En grupp psykotiska symtom som förekommer under
eller efter bruk av psykoaktiva substanser men som
inte enbart kan förklaras med akut intoxikation och
som inte ingår i abstinensen. Tillståndet
karakteriseras av hallucinationer (där
hörselhallucinationer är vanligast, men
hallucinationer för flera sensoriska modaliteter ofta
förekommer), förändrade perceptioner,
vanföreställningar (oftast paranoida eller
anklagande till sin natur), psykomotoriska störningar
(excitation eller stupor) och abnorma affekter som
kan spänna från intensiv rädsla till extas. Sensoriet
är oftast klart men någon grad av
medvetandegrumling, dock ej uttalad konfusion, kan
förekomma.
Alkohol:
• hallucinos
• paranoia
• psykos UNS
• svartsjuka
Utesluter:
Kvardröjande och sent debuterande psykotisk
störning, alkoholutlöst eller orsakad av annan
psykoaktiv substans (F10-F19 med gemensam
fjärdeposition .7)
.6 Amnesisyndrom
Ett syndrom som är associerat med kronisk, uttalad
försämring av när- och fjärrminne. Omedelbar
hågkomst är vanligtvis bevarad. Närminnet är
karakteristiskt nog mer stört än fjärrminnet.
Störningar av tidsuppfattning och händelseordning
är ofta märkbara, liksom svårigheter att lära in nytt
material. Konfabulationer kan vara ett framträdande
drag men förekommer inte alltid. Andra kognitiva
funktioner är vanligtvis relativt välbevarade och
minnesdefekterna är proportionellt större än de
övriga störningarna.
Amnestisk störning, alkohol- eller
läkemedelsutlöst
Korsakoffs psykos eller syndrom, alkoholutlöst
eller orsakat av annan psykoaktiv substans eller
ospecificerat
Utesluter:
Icke alkoholutlöst Korsakoffs syndrom (F04)
Tilläggskod (G32.8*E51.2†) kan användas för att
ange samtidigt förekommande Wernickes sjukdom
eller syndrom
.7 Psykotisk störning som resttillstånd eller med sen
debut
En störning där av alkohol eller psykoaktiva
substanser inducerade förändringar av kognition,
affekter, personlighet eller beteende kvarstår efter
den period då de direkta effekterna av den
psykoaktiva substansen kan antas ha avklingat.
Tillståndet bör debutera i direkt anslutning till bruket
av den psykoaktiva substansen. I fall där den initiala
debuten inträffar senare skall denna kod användas
bara när det finns starka och klara bevis för att den
psykoaktiva substansen varit utlösande. Återtrippar
(”flashbacks”) kan skiljas från psykotiska tillstånd
då dessa dels är episodiska och ofta av mycket kort
duration, dels liknar tidigare upplevelser som
betingats av alkohol eller psykoaktiva substanser.
Demens och andra lättare former av bestående
kognitiva störningar
Kroniskt hjärnsyndrom utlöst av alkohol
Kvarstående affektivt syndrom
Kvarstående störning av personlighet och
beteende
Posthallucinatorisk perceptionsstörning
Sent debuterande psykotisk störning utlöst av
psykoaktiva substanser
Återtrippar (”flashbacks”)
Utesluter:
Av alkohol- eller psykoaktiv substans utlöst:
• Korsakoffs syndrom (F10-F19 med gemensam
fjärdeposition .6)
• Psykotiskt tillstånd (F10-F19 med gemensam
fjärdeposition .5)
181
.8 Andra specificerade psykiska störningar och
beteendestörningar
.9 Psykisk störning och beteendestörning,
ospecificerad
F10
Psykiska störningar och
beteendestörningar orsakade
av alkohol
Perturbationes mentis et morum
ab usu alcoholico provocatae
(För uppdelning på fjärdepositioner se ovan)
F10.2A
Alkoholberoendesyndrom med
fysiologiska tecken på beroende
F10.2B
Alkoholberoendesyndrom utan
fysiologiska tecken på beroende
F10.2X
Alkoholberoendesyndrom, ospecificerad
F10.7A
Alkoholdemens
F10.7W
Alkoholorsakade psykiska störningar
och beteendestörningar som resttillstånd
eller med sen debut, utom
alkoholdemens
F11
Psykiska störningar och
beteendestörningar orsakade
av opioider
Perturbationes mentis et morum
ab usu opioidum provocatae
(För uppdelning på fjärdepositioner se ovan)
F12
Psykiska störningar och
beteendestörningar orsakade
av cannabis
Perturbationes mentis et morum
ab usu cannabis provocatae
(För uppdelning på fjärdepositioner se ovan)
F13
Psykiska störningar och
beteendestörningar orsakade
av sedativa och hypnotika
F18
Perturbationes mentis et morum,
ab usu solventium volatilium
provocatae
Perturbationes mentis et morum
ab usu sedativorum et
hypnoticorum provocatae
(För uppdelning på fjärdepositioner se ovan)
(För uppdelning på fjärdepositioner se ovan)
F14
F19
Psykiska störningar och
beteendestörningar orsakade
av kokain
Perturbationes mentis et morum,
ab usu cocaini provocatae
(För uppdelning på fjärdepositioner se ovan)
F15
Psykiska störningar och
beteendestörningar orsakade
av andra stimulantia, däribland
koffein
Perturbationes mentis et morum,
ab aliis stimulantibus, coffeino
incluso, provocatae
(För uppdelning på fjärdepositioner se ovan)
F16
Psykiska störningar och
beteendestörningar orsakade
av hallucinogener
Psykiska störningar och
beteendestörningar orsakade
av flera droger i kombination
och av andra psykoaktiva
substanser
Perturbationes mentis et morum,
ab usu multiplici
medicamentorum et ab usu
aliorum substantiarum
psychoactivarum provocatae
(För uppdelning på fjärdepositioner se ovan)
Denna kategori tillämpas när det är känt att
två eller flera psykoaktiva substanser
använts men när det är omöjligt att avgöra
vilken som bidragit mest till störningen.
Kategorin skall användas även när en eller
flera av substanserna är okända eller inte
med säkerhet kunnat identifieras, då många
missbrukare ofta inte själva vet vad de tagit
för substans.
Innefattar:
Missbruk av droger UNS
Perturbationes mentis et morum,
ab usu hallucinogenum
provocatae
(För uppdelning på fjärdepositioner se ovan)
F17
Psykiska störningar och
beteendestörningar orsakade
av flyktiga lösningsmedel
Psykiska störningar och
beteendestörningar orsakade
av tobak
Perturbationes mentis et morum,
ab usu tabaci provocatae
(För uppdelning på fjärdepositioner se ovan)
182
SCHIZOFRENI, SCHIZOTYPA
STÖRNINGAR OCH
VANFÖRESTÄLLNINGSSYNDROM
(F20-F29)
Akut (odifferentierad) schizofreni
(F23.2)
Cyklisk schizofreni (F25.2)
Schizofren reaktion (F23.2)
Schizotyp störning (F21)
Schizophrenia, perturbationes
schizotypicae et perturbationes
illusionum
F20.0
Paranoid schizofreni domineras av relativt
stabila, ofta paranoida vanföreställningar,
vanligtvis åtföljda av hallucinationer,
särskilt hörselhallucinationer, och
perceptionsstörningar. Affektstörningar,
viljestörningar, språkstörningar och
katatona symtom saknas eller är föga
framträdande.
Parafren schizofreni
I detta avsnitt sammanförs gruppens viktigaste diagnos,
schizofreni, med schizotyp störning, bestående
vanföreställningssyndrom och en större grupp av akuta
och övergående psykotiska tillstånd. Även
schizoaffektiva psykoser har placerats här, trots deras
kontroversiella natur.
F20
Paranoid schizofreni
Utesluter:
Involutionsparanoida tillstånd (F22.8)
Paranoia (F22.0)
Schizofreni
Schizophrenia
Schizofrena syndrom karakteriseras
vanligtvis av fundamentala och
karakteristiska störningar av tänkande och
perception samt av inadekvata eller flacka
affekter. Medvetande och intellektuell
kapacitet är vanligtvis bevarade; vissa
kognitiva brister kan dock uppträda under
sjukdomens gång. De viktigaste
psykopatologiska fenomenen inkluderar
tankeeko, tankepåsättning eller
tankedetraktion, tankeutbredning,
vanföreställningar om kontroll och styrning,
påverkningsupplevelser eller passivitet,
hallucinationer med röster som
kommenterar eller diskuterar patienten i
tredje person, tankestörningar och negativa
symtom.
Förloppet vid schizofreni kan vara
kontinuerligt, episodiskt med progressivt
eller stabilt defekttillstånd, eller episodiskt
med fullständig eller inkomplett remission.
Diagnosen schizofreni får inte ställas vid
närvaro av uttalade depressiva eller
maniska symtom om det inte står klart att de
schizofrena symtomen debuterade före den
affektiva störningen. Diagnosen skall inte
heller ställas vid närvaro av uppenbar
hjärnsjukdom eller vid tillstånd med
intoxikation med psykoaktiva substanser
eller under abstinens. Liknande tillstånd
som utvecklas i samband med epilepsi eller
annan cerebral sjukdom skall klassificeras
under F06.2 och de tillstånd som inducerats
av psykoaktiva substanser under F10-F19
med gemensam fjärdeposition .5
Utesluter:
183
F20.1
Hebefren schizofreni
En form av schizofreni med uttalade
affektiva förändringar, vanföreställningar
och hallucinationer som är flyktiga och
fragmentariska, oansvarigt och oberäkneligt
beteende och inte sällan manerlighet.
Grundstämningen är indifferent och
inadekvat, tankarna desorganiserade och
talet inkoherent. Social isolering är vanligt
förekommande. Prognosen är oftast dålig
pga de negativa symtomens snabba
utveckling, i synnerhet avflackade affekter
och viljestörning. Hebefreni skall vanligtvis
diagnostiseras bara under ungdomsåren och
hos unga vuxna.
Desorganiserad schizofreni
Hebefreni
F20.2
F20.5
Kataton schizofreni
Kataton schizofreni domineras av uttalade
psykomotoriska störningar som kan
alternera mellan ytterligheter som
hyperkinesi och stupor eller automatisk
lydnad och negativism. Onaturliga
kroppsställningar och poser kan intas under
längre perioder. Episoder med våldsam
excitation kan vara ett slående fenomen vid
detta tillstånd. De katatona fenomenen kan
kombineras med drömlika (oneiroida)
tillstånd med livliga sceniska
hallucinationer.
Kataton stupor
Schizofren:
• flexibilitas cerea
• katalepsi
• katatoni
F20.3
Ett kroniskt tillstånd i förloppet av ett
schizofrent syndrom där det har varit en
tydlig utveckling från tidigt, aktivt stadium
till senare stadium, karakteriserat av
långvariga, dock ej nödvändigtvis
irreversibla, negativa symtom såsom
psykomotorisk retardation, underaktivitet,
flacka affekter, passivitet och brist på
initiativ, ordfattigdom eller innehållslöst tal,
bristfällig icke-verbal kommunikation med
nedsatt ansiktsmimik, ögonkontakt,
röstmodulation och gester, sviktande
förmåga att ta hand om sig själv och
bristfälliga sociala kontakter.
Kronisk odifferentierad schizofreni
Restzustand (schizofren)
Schizofrent residualtillstånd
F20.6
Odifferentierad schizofreni
F20.4
F20.8
Postschizofren depression
En depressiv episod som kan vara långvarig
och som uppstår i efterförloppet av en
schizofren sjukdomsepisod. Några
schizofrena symtom, positiva eller negativa,
måste fortfarande vara närvarande men de
dominerar inte längre den kliniska bilden.
Det depressiva tillståndet är associerat med
ökad suicidrisk. Om patienten inte längre
har några schizofrena symtom bör
tillståndet kodas som en depressiv episod
(F32.-). Om schizofrena symtom fortfarande
är florida och framträdande bör den
relevanta diagnosen ur någon av de
schizofrena undergrupperna (F20.0-F20.3)
väljas.
184
Schizofreni, simplexform
Ett tillstånd med smygande men
fortskridande utveckling av bisarra
beteendestörningar, oförmåga att möta krav
från samhället och en nedgång i
funktionsförmåga i stort. De karakteristiska
negativa fenomenen vid residualschizofreni
(t ex affektavflackning och viljestörning)
uppträder utan att föregås av uppenbart
psykotiska symtom.
Ett psykotiskt tillstånd som uppfyller
generalkriterierna för schizofreni men som
inte kan inordnas i någon av subgrupperna
F20.0- F20.2, eller som innehåller drag från
flera subgrupper utan att någon av dem
dominerar.
Atypisk schizofreni
Utesluter:
Akut schizofreniliknande psykos (F23.2)
Kronisk odifferentierad schizofreni
(F20.5)
Postschizofren depression (F20.4)
Schizofrent resttillstånd
Annan specificerad schizofreni
Cenestopatisk schizofreni
Schizofreniform:
• psykos UNS
• störning UNS
Utesluter:
Kortvarig schizofreniform störning
(F23.2)
F20.9
Schizofreni, ospecificerad
F21
Schizotyp störning
F22.0
Ett tillstånd karakteriserat av utveckling av
en eller flera besläktade vanföreställningar
som oftast är kvarstående och ibland
livslånga. Innehållet i vanföreställningen
eller vanföreställningarna är mycket
varierande. Klara och kvarstående
rösthallucinationer, schizofrena symtom
såsom vanföreställningar om kontroll och
markant avtrubbade affekter samt säkra
tecken på hjärnsjukdom är alla oförenliga
med denna diagnos. Emellertid kan
tillfälliga eller övergående
hörselhallucinationer, särskilt hos äldre
patienter, inte utesluta diagnosen så länge
hallucinationerna inte är schizofrena och
endast utgör en liten del av den kliniska
bilden.
Parafreni (sen)
Paranoia
Paranoid psykos
Paranoiskt tillstånd
Sensitiver Beziehungswahn
Perturbatio schizotypica
En störning som karakteriseras av
excentriskt beteende och egendomligheter i
tankegång och affekter som liknar dem man
kan se vid schizofreni, även om det inte vid
någon tidpunkt finns säkra och
karakteristiska schizofrena symtom.
Symtomen kan inkludera kyliga eller
inadekvata affekter, anhedoni, udda eller
excentriskt beteende, en tendens till social
tillbakadragenhet, och paranoida eller
bisarra idéer som inte antar valören av
riktiga vanföreställningar. Dessutom kan det
finnas tvångsmässigt ältande, tanke- och
perceptionsstörningar, enstaka övergående
psykosliknande episoder med intensiva
illusioner, hörselhallucinationer eller andra
hallucinationer och
vanföreställningsliknande idéer som
vanligtvis uppstår utan någon yttre
provokation. Någon säker tidpunkt för
sjukdomsdebuten kan inte anges och
tillståndets utveckling och förlopp har
karaktären av en personlighetsstörning.
Latent schizofren reaktion
Schizofreni:
• borderline
• latent
• prepsykotisk
• prodromal
• pseudoneurotisk
• pseudopsykopatisk
Schizotyp personlighetsstörning
Utesluter:
Paranoid:
• personlighetsstörning (F60.0)
• psykos, psykogen (F23.3)
• reaktion (F23.3)
• schizofreni (F20.0)
F22.8
Kroniska
vanföreställningssyndrom
Perturbationes illusionum
chronicae
F22.9
Denna grupp omfattar diverse tillstånd där
långvariga vanföreställningar, vilka inte kan
klassificeras som organiska, schizofrena
eller affektiva, utgör det enda eller mest
framträdande kliniska draget.
Vanföreställningssyndrom som har varat
kortare tid än några få månader skall
klassificeras, åtminstone temporärt, under
F23.-.
185
Andra specificerade kroniska
vanföreställningssyndrom
Tillstånd där vanföreställningen eller
vanföreställningarna åtföljs av kvarstående
rösthallucinationer eller schizofrena symtom
som inte motiverar diagnosen schizofreni
(F20.-)
Dysmorfofobi av
vanföreställningskaraktär
Involutionsparanoida tillstånd
Kverulansparanoia
Utesluter:
Aspergers syndrom (F84.5)
Schizoid personlighetsstörning (F60.1)
F22
Vanföreställningssyndrom
Kroniskt vanföreställningssyndrom,
ospecificerat
F23
Akuta och övergående
psykotiska syndrom
F23.1
En akut psykotisk störning med den
polymorfa och instabila kliniska bild som
beskrivs i F23.0. Trots denna instabila
prägel föreligger vissa för schizofreni
typiska symtom under större delen av tiden.
Om de schizofrena symtomen kvarstår skall
diagnosen ändras till schizofreni (F20.-).
Bouffée délirante med schizofren
sjukdomsbild
Cykloid psykos med schizofren
sjukdomsbild
Perturbationes psychoticae
acutae et transitoriae
En heterogen grupp av tillstånd som
karakteriseras av akut debut av psykotiska
symtom såsom vanföreställningar,
hallucinationer, perceptionsstörningar och
allvarliga störningar av det normala
beteendet. Akut debut definieras som
utvecklingen inom loppet av två veckor eller
mindre av en klart abnorm klinisk bild. Vid
dessa tillstånd finns inga bevis för organisk
genes. Rådvillhet och förvirring förekommer
ofta men desorientering med avseende på
tid, rum eller person kvarstår inte tillräckligt
länge eller i tillräckligt hög grad för att leda
misstanken till ett organiskt deliriöst
tillstånd (F05.-). Fullständig remission
inträder vanligtvis inom några få månader,
ofta redan inom några veckor eller till och
med dagar. Om tillståndet blir långdraget
skall en annan kod väljas. Tillståndet kan
vara föregånget av akut stress eller trauma
som uppträtt de sista 1-2 veckorna före
psykosdebuten men detta är inget villkor för
diagnosen.
F23.0
F23.2
Akut schizofreniliknande psykos
En akut psykotisk störning där de psykotiska
symtomen är relativt stabila och uppfyller
kriterierna för diagnosen schizofreni; de har
dock inte varat längre än en månad. Den
polymorfa, instabila bilden som beskrivs i
F23.0 är frånvarande. Om de schizofrena
symtomen kvarstår skall diagnosen ändras
till schizofreni (F20.-).
Akut (odifferentierad) schizofreni
Kortvarig schizofreniform psykos
Kortvarig schizofreniform störning
Oneirofreni
Schizofren reaktion
Akut polymorf psykos utan egentlig
schizofren sjukdomsbild
En akut psykotisk störning, där
hallucinationer, vanföreställningar eller
perceptionsstörningar är tydliga symtom
som dock varierar från dag till dag eller
från timme till timme. Det emotionella
tillståndet är ofta kaotiskt med hastigt
skiftande och intensiva känslor av lycka,
extas, ångest eller irritabilitet. Polymorfism
och instabilitet är karakteristiska för den
samlade kliniska bilden och de psykotiska
symtomen som uppträder berättigar inte till
diagnosen schizofreni (F20.-). Dessa
tillstånd är ofta snabbt insättande och full
sjukdomsutveckling nås inom några få
dagar. Även restitutionen går snabbt utan
tecken på återfall. Vid kvarstående symtom
bör diagnosen ändras till kroniskt
vanföreställningssyndrom (F22.-).
Bouffée délirante utan schizofren
sjukdomsbild eller ospecificerad
Cykloid psykos utan schizofren
sjukdomsbild eller ospecificerad
Akut polymorf psykos med schizofren
sjukdomsbild
Utesluter:
Organiskt vanföreställningssyndrom
[schizofreniliknande] (F06.2)
Schizofreniform störning UNS (F20.8)
F23.3
Annat akut vanföreställningssyndrom
Akuta psykotiska störningar med relativt
stabila vanföreställningar eller
hallucinationer som främsta kliniska drag
utan att dessa symtom motiverar diagnosen
schizofreni (F20.-). Om
vanföreställningarna kvarstår skall
diagnosen ändras till kroniskt
vanföreställningssyndrom (F22.-).
Paranoid reaktion
Psykogen paranoid psykos
F23.8
Andra specificerade akuta och
övergående psykoser
Andra akuta psykotiska störningar där
tecken på organisk etiologi saknas eller där
symtomen inte motiverar diagnos under
F23.0-F23.3.
F23.9
Akut och övergående psykos,
ospecificerad
Kortvarig reaktiv psykos UNS
Reaktiv psykos
186
F24
Inducerat
vanföreställningssyndrom
F25.1
Ett syndrom där både schizofrena symtom
och depressiva symtom är uttalade, varför
sjukdomsepisoden inte låter sig beskrivas
med någon av diagnoserna schizofreni eller
depressiv episod. Denna kategori kan
användas för både enstaka och
återkommande episoder där majoriteten av
episoderna är schizoaffektivt syndrom,
depressiv typ.
Schizoaffektiv psykos, depressiv typ
Schizofreniform psykos, depressiv typ
Perturbatio illusionum provocata
Ett vanföreställningssyndrom som delas av
två eller flera personer med nära emotionell
kontakt. Bara en av personerna lider av en
genuin psykotisk störning. Hos den andra
eller de andra är vanföreställningarna
inducerade och upphör vanligtvis när
personerna separeras.
Folie à deux
Inducerad paranoid störning
Inducerad psykotisk störning
F25
Episodiska psykotiska syndrom där både
affektiva och schizofrena symtom är uttalade
men där ingen av diagnoserna schizofreni,
depressiv episod eller manisk episod kan
ställas. Andra tillstånd där affektiva symtom
uppträder som pålagring hos en patient med
sedan tidigare diagnostiserad schizofreni
eller uppträder samtidigt med eller
omväxlande med andra varaktiga
vanföreställningssyndrom klassificeras
under F20-F29. Stämningsinkongruenta
psykotiska symtom vid affektiv sjukdom
berättigar inte till diagnosen schizoaffektivt
syndrom.
F25.0
F25.2
Schizoaffektivt syndrom, blandad typ
F25.8
Annat specificerat schizoaffektivt
syndrom
F25.9
Schizoaffektivt syndrom, ospecificerat
F28
Andra icke organiska
psykotiska störningar
Schizoaffektiva syndrom
Perturbationes schizoaffectivae
Blandad schizofren och affektiv psykos
Cyklisk schizofreni
Schizoaffektiv psykos UNS
Aliae perturbationes phychoticae
non organicae
Vanföreställningsstörningar eller
hallucinatoriska störningar som inte ger
stöd för diagnoserna schizofreni (F20.-),
kroniskt vanföreställningssyndrom (F22.-),
akuta och övergående psykoser (F23.-),
mani med psykotiska symtom (F30.2) eller
svår depressiv episod (F32.3).
Kronisk hallucinatorisk psykos
Schizoaffektivt syndrom, manisk typ
Ett syndrom där både schizofrena symtom
och maniska symtom är uttalade, varför
sjukdomsepisoden inte låter sig beskrivas
med någon av diagnoserna schizofreni eller
manisk episod. Denna kategori kan
användas för både enstaka och
återkommande episoder där majoriteten av
episoderna är schizoaffektivt syndrom,
manisk typ.
Schizoaffektiv psykos, manisk typ
Schizofreniform psykos, manisk typ
Schizoaffektivt syndrom, depressiv
typ
F29
Ospecificerad icke organisk
psykos
Psychosis non organica non
specificata
Psykos UNS
Utesluter:
Organisk eller symtomatisk psykos UNS
(F09)
Psykisk störning (F99)
187
FÖRSTÄMNINGSSYNDROM (F30-F39)
F30.1
Stämningsläget är förhöjt på ett sätt som
stämmer illa med patientens situation och
kan variera från obekymrad jovialitet till i
det närmaste okontrollerbar excitation. Den
förhöjda stämningen åtföljs av ökad energi,
vilket leder till överaktivitet, ökat talflöde
och nedsatt sömnbehov.
Koncentrationsförmågan blir sämre och det
finns ofta en tydlig distraherbarhet.
Självuppfattningen är ofta påverkad av
grandiosa idéer och överdriven självtillit.
Brist på normala sociala spärrar kan
resultera i ett beteende som är hänsynslöst,
dumdristigt, inadekvat med hänsyn till
omständigheterna och som skiljer sig
markant från individens normala mönster.
Perturbationes animi affectivae
Detta avsnitt innehåller tillstånd där den grundläggande
störningen är en förändring i stämningsläget, endera i
riktning mot depression (med eller utan åtföljande
ångest) eller mot förhöjd grundstämning.
Förskjutningarna i stämningsläge är ofta åtföljda av
förändringar i aktivitetsnivå. De övriga symtomen är
mestadels antingen lätta att förstå om de sätts i relation
till förändringen i stämningsläge och aktivitetsnivå eller
sekundära till denna förändring. De flesta
förstämningssyndromen är återkommande och den
aktuella episoden har ofta föregåtts av belastande
händelser eller situationer.
F30
Manisk episod
F30.2
Episodium manicum
Innefattar:
Bipolär störning, enstaka manisk episod
Hypomani
En störning som karakteriseras av en
bestående, lätt förhöjd grundstämning, ökad
energi och ökad aktivitet. Patienten har
oftast en uttalad känsla av välbefinnande
och av fysisk och mental effektivitet. Ökad
utåtriktning, pratgladhet, överdriven
förtrolighet, ökad sexualdrift och nedsatt
sömnbehov föreligger ofta men inte till den
grad att det allvarligt påverkar
arbetsförmågan eller är socialt
komprometterande. Irritabilitet, fåfänga och
tölpaktigt beteende kan ibland ersätta den
mera vanligt förekommande euforiska
fryntligheten. Störningarna i stämningsläge
och beteende åtföljs inte av hallucinationer
eller vanföreställningar.
188
Mani med psykotiska symtom
Till den kliniska bilden som beskrivs under
F30.1 tillkommer vanföreställningar
(vanligtvis grandiosa) eller hallucinationer
(vanligtvis röster som talar direkt till
patienten). Excitation, motorisk
hyperaktivitet och tankeflykt kan förekomma
till sådan grad att det blir svårt eller
omöjligt att förstå eller etablera kontakt med
patienten.
Mani med stämningskongruenta
psykotiska symtom
Mani med stämningsinkongruenta
psykotiska symtom
Manisk stupor
Subkategorierna gäller endast för enstaka
episoder. Hypomana eller maniska episoder
hos individer som tidigare har haft en eller
flera affektiva episoder (depressiva,
hypomana, maniska eller blandtillstånd)
skall kodas som bipolär sjukdom (F31.-).
F30.0
Mani utan psykotiska symtom
F30.8
Andra specificerade maniska episoder
F30.9
Manisk episod, ospecificerad
Mani UNS
F31
Bipolär sjukdom
F31.4
Perturbatio affectiva bipolaris
Ett tillstånd karakteriserat av två eller flera
episoder då en märkbar förändring i
patientens stämningsläge och aktivitetsnivå
inträder. Ibland består förändringen i
förhöjd stämning med ökad energi och
aktivitet (hypomani eller mani), ibland
depressiv förstämning med nedsatt energi
och aktivitetsnivå. Återkommande episoder
av enbart hypomani eller mani klassificeras
som bipolär sjukdom
Innefattar:
Manodepressiv psykos
Manodepressiv reaktion
Manodepressiv sjukdom
Utesluter:
Bipolär störning, enstaka manisk episod
(F30.-)
Cyklotymi (F34.0)
F31.0
F31.1
Patienten är deprimerad som vid en svår
depressiv episod utan psykotiska tecken
(F32.2) och har tidigare haft minst en
väldokumenterad episod med hypomani,
mani eller blandtillstånd.
F31.5
F31.6
Utesluter:
Enstaka blandad förstämningsepisod
(F38.0)
F31.7
Bipolär sjukdom, manisk episod utan
psykotiska symtom
F31.3
Bipolär sjukdom, lindrig eller
medelsvår depressiv episod
Patienten är deprimerad som vid en
depressionsepisod av lindrig eller medelsvår
grad (F32.0 eller F32.1) och har tidigare
haft minst en väldokumenterad episod av
hypomani, mani eller blandtillstånd.
189
Bipolär sjukdom utan aktuella
symtom
Patienten har tidigare haft minst en
väldokumenterad episod med hypomani,
mani eller blandtillstånd och dessutom minst
en annan affektiv episod med depression,
hypomani, mani eller blandtillstånd. Någon
aktuell stämningsförskjutning finns dock inte
och har ej heller varit märkbar de senaste
månaderna. Remissionsperioder under
profylaktisk behandling kodas här.
Bipolär sjukdom, manisk episod med
psykotiska symtom
Patienten befinner sig i ett maniskt tillstånd
med psykotiska symtom (enligt definitionen
under F30.2) och har haft minst en tidigare
affektiv episod (hypomani, mani, depression
eller blandtillstånd).
Bipolär sjukdom, blandad episod
Patienten uppvisar antingen en blandning av
eller en snabb växling mellan maniska och
depressiva symtom och har tidigare haft
minst en väldokumenterad affektiv period
(hypomani, mani, depression eller
blandtillstånd).
Patienten befinner sig i ett maniskt tillstånd
utan andra psykotiska symtom (enligt
definitionen under F30.1) och har haft minst
en tidigare affektiv episod (hypomani, mani,
depression eller blandtillstånd).
F31.2
Bipolär sjukdom, svår depressiv
episod med psykotiska symtom
Patienten är deprimerad som vid svår
depressiv episod med psykotiska symtom
(F32.3) och har tidigare haft minst en
väldokumenterad episod med hypomani,
mani eller blandtillstånd.
Bipolär sjukdom, hypoman episod
Patienten befinner sig i ett hypomant
tillstånd (enligt definitionen under F30.0)
och har haft minst en tidigare affektiv episod
(hypomani, mani, depression eller
blandtillstånd)
Bipolär sjukdom, svår depressiv
episod utan psykotiska symtom
F31.8
Andra specificerade bipolära
sjukdomar
Bipolär, typ 2-störning
Recidiverande maniska episoder UNS
F31.9
Bipolär sjukdom, ospecificerad
F32
Depressiv episod
F32.2
Episodium depressivum
Vid typiska episoder med lindrig (F32.0),
medelsvår (F32.1) eller svår (F32.2 och
F32.3) depression ses sänkt stämningsläge,
minskad energi och nedsatt aktivitetsnivå.
Förmågan att glädja sig, uppleva intresse
och koncentrera sig är nedsatt och det finns
en uttalad trötthet även efter ett minimum av
ansträngning. Sömnstörning och aptitförlust
är vanligt förekommande. Självkänsla och
självtillit är nästan alltid reducerad och
även vid lindriga depressionsepisoder är
skuldkänslor eller ringhetsidéer ofta
närvarande. Vid medelsvåra eller svåra
depressioner varierar det sänkta
stämningsläget föga från dag till dag eller
som svar på händelser i omgivningen.
Depressionen kan vara ledsagad av
somatiska symtom såsom intresseförlust,
glädjelöshet, uppvaknande flera timmar
tidigare än normalt på morgonen,
dygnsvariation där de depressiva symtomen
är som värst på morgonen, uttalad
psykomotorisk hämning eller agitation,
aptitlöshet, viktförlust och nedsatt libido.
En depressionsepisod där ett flertal av
ovannämnda symtom, vanligen låg
självkänsla, skuldkänslor och ringhetsidéer,
är närvarande i uttalad och plågsam form.
Självmordstankar och självmordshandlingar
är vanliga och ett antal somatiska symtom
är oftast närvarande.
Agiterad depression
Egentlig depression
Vital depression
F32.3
Innefattar:
Enstaka episoder av:
• depressiv reaktion
• psykogen depression
• reaktiv depression
F32.3A
Uppgivenhetssyndrom
F32.3W
Annan svår depressiv episod med
psykotiska symtom
Utesluter:
Anpassningsstörning (F43.2)
Depressiv episod förenad med
beteendestörning under F91.- (F92.0)
Recidiverande depressiva episoder
(F33.-)
F32.8
Andra specificerade depressiva
episoder
Lindrig depressiv episod
F32.9
Atypisk depression
Enstaka episoder med maskerad
depression UNS
Övriga depressioner
Två eller tre av ovannämnda symtom finns
närvarande. Patienten är vanligtvis
påverkad av tillståndet men är oftast i stånd
att fortsätta med de flesta av sina aktiviteter.
F32.1
Svår depressiv episod med psykotiska
symtom
Depressiv episod som under F32.2 men med
hallucinationer, vanföreställningar,
psykomotorisk hämning eller stupor av så
allvarlig grad att vanliga sociala aktiviteter
omöjliggörs. Tillståndet kan vara
livshotande pga självmord, dehydrering
eller svält. Hallucinationerna och
vanföreställningarna är inte nödvändigtvis
stämningskongruenta.
Enstaka episoder med:
• depressiv psykogen psykos
• depressiv reaktiv psykos
• egentlig depression med psykotiska
symtom
• psykotisk depression
Beroende på symtomens antal och
allvarlighetsgrad kan en depressiv episod
klassificeras som lindrig, medelsvår eller
svår.
F32.0
Svår depressiv episod utan psykotiska
symtom
Medelsvår depressiv episod
Fyra eller flera av ovannämnda symtom
finns närvarande. Patienten har troligen
svårt att fortsätta med sina ordinarie
aktiviteter.
190
Depressiv episod, ospecificerad
Depression UNS
Depressiv störning UNS
F33
Recidiverande depressioner
F33.2
Depressiones recurrentes
En störning som karakteriseras av
återkommande depressiva episoder enligt
definitionen under depressiv episod F32.men utan anamnes på oberoende episoder
med förhöjt stämningsläge och ökad
energinivå (mani). Det kan emellertid
förekomma korta episoder med lätt förhöjt
stämningsläge och överaktivitet (hypomani)
omedelbart efter en depressiv episod, ibland
utlösta av antidepressiv medicinering. De
djupare formerna av recidiverande
depressioner (F33.2 och F33.3) har mycket
gemensamt med bipolär sjukdom, egentlig
depression, endogen depression och vital
depression. Den första episoden kan
uppträda när som helst i livet, från
barndomen till seniet. Sjukdomsdebuten kan
vara akut eller smygande och varaktigheten
från veckor till många månader. Risken för
att en patient med recidiverande
depressioner skall drabbas av en manisk
episod försvinner aldrig helt, oavsett antalet
tidigare episoder. Om en manisk episod
inträffar, bör diagnosen ändras till bipolär
sjukdom (F31.-).
En sjukdom som karakteriseras av
återkommande depressionsepisoder. Den
aktuella episoden är svår, dock utan
psykotiska symtom som under F32.2, och
anamnes på manisk episod saknas.
Bipolär sjukdom, depressiv episod, utan
psykotiska symtom
Egentlig recidiverande depression utan
psykotiska symtom
Endogen depression utan psykotiska
symtom
Vital depression, recidiverande utan
psykotiska symtom
F33.3
F33.0
F33.4
Recidiverande depression utan
aktuella symtom
Patienten har tidigare haft två eller flera
depressiva episoder enligt definitionen
under F33.0-F33.3 men är sedan flera
månader fri från depressiva symtom.
Recidiverande depression, lindrig
episod
En sjukdom som karakteriseras av
återkommande depressionsepisoder. Den
aktuella episoden är lindrig som under
F32.0, och anamnes på manisk episod
saknas.
F33.1
Recidiverande depression, svår episod
med psykotiska symtom
En sjukdom som karakteriseras av
återkommande depressionsepisoder. Den
aktuella episoden är svår och det finns
psykotiska symtom, som under F32.3.
Anamnes på tidigare maniska episoder
saknas.
Bipolär sjukdom, depressiv episod, med
psykotiska symtom
Depressiv psykogen psykos med
psykotiska symtom
Depressiv reaktiv psykos
Egentlig depression med psykotiska
symtom
Endogen depression med psykotiska
symtom
Psykotisk depression
Innefattar:
Recidiverande episoder med:
• depressiv reaktion
• psykogen depression
• reaktiv depression
Årstidsrelaterad depression
Utesluter:
Recidiverande kortvariga
depressionsepisoder (F38.1)
Recidiverande depression, svår episod
utan psykotiska symtom
Recidiverande depression, medelsvår
episod
En sjukdom som karakteriseras av
återkommande depressionsepisoder. Den
aktuella episoden är medelsvår, som under
F32.1 och anamnes på manisk episod
saknas.
191
F33.8
Andra specificerade recidiverande
depressioner
F33.9
Recidiverande depression,
ospecificerad
Långvarig depression UNS
F34
Kroniska
förstämningssyndrom
F38
Aliae perturbationes mentis
affectivae
Perturbationes mentis affectivae
chronicae
Varaktiga och ofta fluktuerande
stämningsförändringar, där de individuella
episoderna inte är tillräckligt uttalade för
att kunna beskrivas som hypomana eller
depressiva episoder av lättare grad. Då
tillstånden varar i många år, ibland större
delen av patientens vuxna liv, orsakar de
avsevärt lidande och invaliditet. I några fall
kan recidiverande eller enstaka maniska
eller depressiva episoder uppträda i
samband med ett kroniskt
förstämningssyndrom.
F34.0
Cyklotymi
Varaktigt instabilt stämningsläge med
åtskilliga episoder av depression och
hypomani, inga av dem dock så svåra eller
långvariga att diagnosen bipolär sjukdom
(F31.-) eller recidiverande depressioner
(F33.-) kan ställas. Störningen är vanligt
förekommande hos anhöriga till patienter
med bipolär sjukdom. Några patienter med
cyklotymi utvecklar så småningom bipolär
sjukdom.
Affektiv personlighetsstörning
Cykloid personlighet
Cyklotym personlighet
F34.1
Dystymi
Ett kroniskt förstämningstillstånd av
depressiv art med flera års varaktighet. Det
är inte tillräckligt svårt och de individuella
episoderna inte tillräckligt långa för att
motivera diagnosen svår, medelsvår eller
recidiverande depression (F33.-) .
Depressiv neuros
Depressiv personlighetsstörning
Neurotisk depression
Varaktigt tillstånd med ångest och
depression
Utesluter:
Tillstånd med ångest och depression
(lindriga eller kortvariga) (F41.2)
F34.8
Andra specificerade kroniska
förstämningssyndrom
F34.9
Kroniskt förstämningssyndrom,
ospecificerat
192
Andra förstämningssyndrom
Andra affektiva sjukdomar som inte
motiverar klassifikation enligt F30-F34 då
de är varken tillräckligt svåra eller
långvariga.
F38.0
Andra enstaka förstämningssyndrom
F38.1
Andra recidiverande
förstämningssyndrom
Blandad affektiv episod
Recidiverande kortvariga depressiva
episoder
F38.8
Andra specificerade
förstämningssyndrom
F39
Ospecificerat
förstämningssyndrom
Perturbationes animi affectivae
non specificatae
Affektiv psykos UNS
NEUROTISKA, STRESSRELATERADE
OCH SOMATOFORMA SYNDROM
(F40-F48)
F40.1
Rädsla för att bli kritiskt granskad av andra
människor, vilket leder till undvikande av
sociala situationer. Mer genomgripande
sociala fobier är vanligtvis associerade med
låg självuppfattning och rädsla för kritik.
Patienter söker ofta hjälp pga rodnad,
tremor, illamående eller urinträngningar.
Patienten är ibland övertygad om att dessa
sekundära manifestationer av ångest är det
primära problemet. Symtomen kan utvecklas
till panikattacker.
Antropofobi
Social neuros
Perturbationes somatoformes et ad
neurosim et stress pertinentes
Utesluter:
När förenade med beteendestörning under F91.(F92.8)
F40
Fobiska syndrom
Perturbationes fobicae
En grupp störningar där ångest uppträder
enbart eller företrädesvis i vissa
väldefinierade situationer som inte innebär
en reell fara. Som en följd av ångesten
undviker patienten dessa situationer eller
uthärdar dem med fasa. Patientens egen oro
kan fokuseras på individuella symtom såsom
hjärtklappning eller svimningskänslor och
är ofta kopplad till en sekundär rädsla för
att dö, mista kontrollen eller bli sinnessjuk.
Blotta tanken på den fobiska situationen kan
framkalla förväntningsångest. Fobisk ångest
och depression uppträder ofta samtidigt. Om
två diagnoser, fobisk ångest och depressiv
episod, skall ställas, eller bara den ena,
avgörs av tidsförloppet och av terapeutiska
överväganden vid undersökningstillfället.
F40.0
Social fobi
F40.2
Fobier begränsade till helt specifika
situationer såsom ångest för speciella djur,
höjder, åskväder, mörker, flygning, stängda
rum, besök på offentliga toaletter, intag av
viss föda, tandläkare, åsyn av blod eller
kroppsskada. Även om den utlösande
situationen är avgränsad eller speciell kan
kontakt med situationen utlösa panikångest
på samma sätt som vid agorafobi och social
fobi.
Akrofobi
Djurfobi
Enkel fobi
Klaustrofobi
Utesluter:
Dysmorfofobi (F45.2)
Nosofobi (F45.2)
Agorafobi
En relativt väldefinierad grupp av fobier
som innefattar rädsla för att lämna hemmet,
gå i affärer, folksamlingar och offentliga
platser eller att resa ensam med tåg, buss
eller flyg. Panikångest uppträder ofta i
förbindelse med agorafobi. Depressiva
symtom, obsessiva symtom och sociala
fobier är också vanligt förekommande
delfenomen. Undvikande av den fobiska
situationen är ofta ett framträdande drag
och några agorafobiska patienter upplever
endast ringa ångest då de klarar av att
undvika de fobiska situationerna.
Agorafobi utan anamnes på
panikattacker
Paniksyndrom med agorafobi
193
Specifika (avgränsade) fobier
F40.2B
Djurfobi
F40.2E
Bromhidrosofobi
F40.2F
Erytrofobi
F40.2G
Parasitofobi
F40.2W
Andra specifika fobier
F40.8
Andra specificerade fobier
F40.9
Fobi, ospecificerad
Fobi UNS
Fobiska tillstånd UNS
F41
Andra ångestsyndrom
F41.2
Aliae perturbationes anxietatis
Denna kategori bör användas när symtom
på både ångest och depression är
närvarande men inget är klart dominerande.
Var för sig är symtomen inte heller
tillräckligt uttalade för att motivera
diagnosen ångestsyndrom eller depressiv
episod. När både ångestsymtom och
depressiva symtom finns närvarande och är
tillräckligt uttalade för att ge stöd åt båda
diagnoserna, kodas de var för sig och denna
kategori används ej.
Tillstånd med ångest och depression,
lindriga eller kortvariga
Tillstånd där ångest är huvudsymtom och
där ångesten inte är begränsad till särskilda
situationer. Depressiva och obsessiva
symtom samt ibland även vissa drag av
fobisk ångest kan vara närvarande, förutsatt
att de uppträder sekundärt eller är mindre
uttalade.
F41.0
Paniksyndrom [episodisk paroxysmal
ångest]
Ett obligat fenomen är återkommande
attacker av svår panikångest, som är
oförutsägbara då de inte är begränsade till
särskilda situationer eller omständigheter.
Liksom vid andra ångestsyndrom är de
dominerande symtomen plötsligt insättande
hjärtklappning, bröstsmärtor,
kvävningskänslor, yrsel och
overklighetskänslor (depersonalisation eller
derealisation). Sekundärt uppträder ofta
rädsla för att dö, att förlora kontrollen eller
att bli sinnessjuk. Panikångest bör inte
användas som huvuddiagnos om patienten
är deprimerad vid tidpunkten då
ångestanfallen startar. Under sådana
omständigheter kan panikattackerna vara
sekundära till depression.
Panikattack
Paniktillstånd
Utesluter:
Paniksyndrom med agorafobi (F40.0)
F41.1
Generaliserat ångestsyndrom
Ångesten är generaliserad och ihållande
men inte begränsad till eller ens mest
markerad i vissa situationer eller
omständigheter (dvs är ¨fritt flytande¨). De
mest framträdande symtomen varierar men
omfattar ihållande nervositet, skakningar,
muskulär spänning, svettningar,
svimningskänsla, hjärtklappning, yrsel och
oro i magen. Rädsla för att själv eller att en
anhörig snart ska bli sjuk eller råka ut för en
olycka anges ofta.
Ångestneuros
Ångestreaktion
Ångesttillstånd
Utesluter:
Neurasteni (F48.0)
194
Blandade ångest- och
depressionstillstånd
F41.3
Andra blandade ångesttillstånd
Ångestsymtom i kombination med drag från
andra tillstånd beskrivna under F42- F48.
Inga av symtomen är allvarliga nog för att
motivera en diagnos om de betraktas var för
sig.
F41.8
Andra specificerade ångesttillstånd
F41.9
Ångesttillstånd, ospecificerat
Ångesthysteri
Ångest UNS
F42
Tvångssyndrom
F42.1
Perturbatio obsessiva compulsiva
Tillståndet karakteriseras av återkommande
tvångstankar eller tvångshandlingar.
Tvångstankarna är idéer, föreställningar
eller impulser som dyker upp i patientens
medvetande gång på gång på ett stereotypt
sätt. Tankarna är nästan alltid plågsamma
och ofta försöker patienten stå emot dem,
dock utan framgång. Tankarna upplevs som
hans eller hennes egna, även om de är
ofrivilliga och ofta motbjudande.
Tvångshandlingar eller ritualer är
stereotypt beteende som upprepas gång på
gång. Handlingarna är varken behagliga
eller ändamålsenliga. Deras funktion är att
förhindra någon av patienten befarad men
objektivt sett osannolik händelse som skulle
kunna vara till risk eller skada för patienten.
Vanligtvis upplevs tvångshandlingar som
meningslösa eller ineffektiva och patienten
gör försök att stå emot att utföra dem.
Ångest finns nästan alltid närvarande och
förvärras om patienten står emot
tvångshandlingarna.
Innefattar:
Anankastisk neuros
Obsessiv-kompulsiv neuros
Obsessiv-kompulsiv störning
Utesluter:
Obsessiv-kompulsiv
personlighetsstörning (F60.5)
F42.0
Tvångssyndrom präglat av
tvångstankar
Ett tillstånd främst präglat av tvångstankar
eller grubblerier som kan ta formen av
idéer, tankebilder eller impulser till
handling. Tillståndet är praktiskt taget alltid
plågsamt för patienten. Ibland kan tankarna
vara ändlösa, villrådiga överväganden över
olika alternativ, vilket leder till oförmåga att
fatta triviala beslut som är nödvändiga för
det dagliga livet. Tvångsmässigt grubbel och
depression är nära förbundna och
diagnosen tvångssyndrom är mest adekvat
när tvångstankar uppstår eller kvarstår utan
att patienten samtidigt har en depressiv
episod.
195
Tvångssyndrom präglat av
tvångshandlingar [tvångsritualer]
Ett tillstånd främst präglat av
tvångshandlingar (tvångsritualer). Oftast
rör handlingarna hygien (främst
handtvättning), upprepade kontroller för att
försäkra sig om att inga farliga situationer
utvecklas eller en överdrivet pedantisk
ordentlighet. Bakom beteendet ligger en
fruktan, vanligtvis för fara som kan skada
eller som är orsakad av patienten. Den
rituella handlingen är ett ineffektivt eller
symboliskt försök att värja sig mot faran.
F42.2
Tvångstankar med tvångshandlingar
F42.8
Andra specificerade tvångssyndrom
F42.9
Tvångssyndrom, ospecificerat
F43
Anpassningsstörningar och
reaktion på svår stress
fuguetillstånd). Autonoma tecken på
panikångest (hjärtklappning, ökad svettning,
rodnad) är ofta närvarande. Symtomen
utvecklas vanligtvis inom några minuter
efter den belastande händelsen eller traumat
och avklingar inom 2-3 dagar (ofta inom
timmar). Partiell eller total amnesi (F44.0)
för episoden kan ses. Om symtomen kvarstår
bör ändring av diagnos (och behandling)
övervägas.
Akut krisreaktion
Akut reaktion på stress
Kristillstånd
Psykisk chock
Stridsutmattning (combat fatigue)
Perturbationes adaptionis et
reactio e stress gravi
Denna kategori skiljer sig från andra då den
inkluderar störningar som karakteriseras
inte bara av symtom och förlopp utan även
inbegriper en av två orsaksfaktorer: 1) en
exceptionellt traumatisk livshändelse som
ger upphov till en akut stressreaktion, eller
2) en betydande förändring av
livssituationen som medför en bestående
försämring av livsvillkoren, vilket resulterar
i en anpassningsstörning. Mindre uttalad
psykosocial belastning eller stress av mindre
allvarlig typ kan visserligen framkalla eller
bidra till utvecklingen av många av de
tillstånd som beskrivs i andra avsnitt i detta
kapitel, men deras etiologiska betydelse är
inte alltid klar och i det enskilda fallet finns
ofta en individuell, idiosynkratisk sårbarhet;
dvs belastningen har inte varit nödvändig
eller tillräcklig för att förklara störningens
uppkomst eller form.
För denna kategori (F43) gäller emellertid
att störningen skall vara en direkt
konsekvens av akut, allvarligt trauma eller
långvarig belastning. De traumatiska
händelserna eller den långvariga
belastningen är den primära och
dominerande orsaksfaktorn och utan någon
av dessa skulle störningen inte ha uppstått.
Störningarna i denna kategori kan betraktas
som maladaptiva reaktioner på allvarlig
eller kontinuerlig belastning då reaktionen
interfererar med ändamålsenliga
anpassningsmekanismer och ger upphov till
nedsatt social funktionsförmåga.
F43.0
Akut stressreaktion
En övergående störning som utvecklas som
reaktion på exceptionell fysisk eller psykisk
belastning hos en individ som inte uppvisar
några tecken på annan psykisk sjukdom.
Tillståndet går över på timmar eller några
få dagar. Individuell sårbarhet och
anpassningsförmåga spelar roll för den
akuta stressreaktionens utveckling och
svårighetsgrad. Symtomen är blandade och
skiftande och består initialt av förvirring
med viss insnävning av medvetande och
uppmärksamhet, oförmåga att uppfatta
stimuli samt desorientering. Detta stadium
kan endera följas av ytterligare flykt undan
omgivningen och situationen (stigande till
dissociativ stupor - F44.2) eller av agitation
och överaktivitet (flyktreaktion eller
196
F43.1
Posttraumatiskt stressyndrom
Ett tillstånd som uppstår som fördröjd eller
långvarig reaktion på en traumatisk
händelse eller situation (av kortare eller
längre varaktighet) av exceptionellt hotande
eller katastrofalt slag, som kan väntas
medföra kraftig påverkan på praktiskt taget
alla människor. Predisponerande faktorer
som personlighetsdrag (tvångsmässiga eller
asteniska) eller anamnes på neurotisk
störning kan sänka tröskeln för risken att
utveckla syndromet eller förvärra förloppet
men de är varken nödvändiga eller
tillräckliga för att förklara uppkomsten.
Typiska fenomen inkluderar episoder av
återupplevande av traumat i form av
påträngande minnen (¨flashbacks¨),
drömmar eller mardrömmar som uppträder
mot en bakgrund av känslomässig stumhet
och avflackning, tillbakadragande från
andra människor, nedsatt reaktivitet på
omgivningsfaktorer, anhedoni och
undvikande av aktiviteter och situationer
som påminner om traumat. Det finns ofta ett
tillstånd av autonom irritabilitet, ökad
vaksamhet och förhöjd alarmberedskap samt
insomnia. Ångest och depression är ofta
förenade med tidigare nämnda symtom och
tecken och självmordstankar är inte
ovanliga. Tillståndet utvecklas efter traumat
med en latenstid som kan variera från några
veckor till månader. Förloppet är
fluktuerande men full remission kan ses i de
flesta fall. Hos en minoritet av patienterna
kan tillståndet bli kroniskt och pågå i många
år, vilket så småningom leder till en varaktig
personlighetsförändring (F62.0).
Traumatisk neuros
F43.2
F44
Anpassningsstörning
Tillstånd med subjektivt obehag och
emotionella störningar som vanligtvis leder
till nedsatt social funktionsförmåga.
Tillståndet uppstår under en period av
nyanpassning till förändrade
livsomständigheter eller belastande
livssituationer. Belastningen kan ha menligt
påverkat individens sociala nätverk
(smärtsam förlust, separation) eller ett
större system av socialt stöd och sociala
värderingar (emigration, flyktingstatus),
eller representera ett utvecklingssteg eller
en kris (börja skolan, bli förälder,
misslyckas med att uppnå ett personligt mål,
pensionering). Individuell predisponering
eller vulnerabilitet spelar en viktig roll i
risken för och utvecklingen av en
anpassningsstörning men det antas att
tillståndet inte skulle ha utvecklats utan den
aktuella belastningen. Manifestationerna
varierar och inkluderar sänkt
grundstämning, ångest eller oro (eller en
blandning av båda), en känsla av
maktlöshet, att inte kunna planera framåt
eller fortsätta på nuvarande sätt, nedsatt
förmåga att utföra dagliga göromål.
Tillståndet kan åtföljas av
beteendestörningar, speciellt hos ungdomar.
Den kliniska bilden kan domineras av korta
eller längre depressionsepisoder eller
störning av andra känslor samt av
beteendet.
Kulturchock
Sorgreaktion
Utesluter:
Separationsångest i barndomen (F93.0)
F43.8
Andra specificerade reaktioner på
svår stress
Innefattar:
Utmattningssyndrom
Anmärkning:
Om vid utmattningssyndrom depression
eller annan specifik psykiatrisk diagnos
föreligger anges denna som
huvuddiagnos. Utmattningssyndrom
anges i dessa fall som bidiagnos
F43.8A
Utmattningssyndrom
F43.8W
Andra specificerade reaktioner på svår
stress än utmattningssyndrom
F43.9
Reaktion på svår stress, ospecificerad
197
Dissociativa syndrom
Perturbationes dissociativae
Det gemensamma för dissociativa tillstånd
eller konversionstillstånd är partiell eller
total förlust av normal integration mellan
minnen av det förflutna, medvetandet om
identitet och omedelbara sensationer samt
kontroll över den kroppsliga motoriken. Alla
typer av dissociativa tillstånd brukar gå i
remission efter några veckor eller månader,
särskilt om de har föregåtts av en traumatisk
livshändelse. Vissa störningar, särskilt
förlamningar och känslobortfall, kan bli mer
kroniska om debuten är associerad med
olösliga problem eller interpersonella
svårigheter. Dessa störningar har tidigare
klassificerats som olika typer av
”konversionshysteri”. De förmodas vara
framkallade av psykologiska faktorer och är
i tid nära förbundna med traumatiska
händelser, olösliga och svårtolererade
problem eller störda relationer. Symtomen
representerar ofta patientens uppfattning om
hur en fysisk sjukdom manifesterar sig.
Medicinsk undersökning och utredning kan
inte avslöja någon känd kroppslig eller
neurologisk sjukdom.
Däremot finns tecken på att
funktionsförlusten är ett uttryck för en
känslomässig konflikt eller känslomässiga
behov. Symtomen kan ha utvecklats i nära
relation till psykologisk stress och uppträder
ofta akut. Bara tillstånd med fysiska
funktioner som normalt står under
viljemässig kontroll samt känslobortfall ska
inkluderas. Tillstånd med smärta och andra
mer komplexa fysiska sensationer medierade
via det autonoma nervsystemet klassificeras
under somatiseringssyndrom (F45.0).
Allvarlig fysisk eller psykisk sjukdom kan
uppenbara sig i ett senare skede och denna
möjlighet måste alltid hållas i minnet.
Innefattar:
Hysteri
Hysterisk psykos
Konversionshysteri
Konversionsreaktion
Utesluter:
Medveten simulering (Z76.5)
F44.0
Dissociativ amnesi
F44.2
Störningens mest framträdande drag är
minnesförlust, vanligen rörande viktiga
händelser av färskt datum. Minnesförlusten
beror inte på organisk sjukdom och är för
uttalad för att kunna förklaras med vanlig
glömska eller trötthet. Amnesin är ofta
fokuserad kring traumatiska händelser,
såsom olyckor och oväntade dödsfall, och är
vanligtvis partiell och selektiv. Total och
generell amnesi är ovanlig och oftast del av
ett fuguetillstånd (F44.1). Om detta är fallet
skall tillståndet klassificeras så. Diagnosen
(dissociativ amnesi) skall inte ställas i
närvaro av organisk hjärnsjukdom,
intoxikation eller excessiv utmattning.
Utesluter:
Amnesi:
• anterograd (R41.1)
• retrograd (R41.2)
• UNS (R41.3)
Amnesi orsakad av alkohol eller andra
psykoaktiva substanser (F10-F19 med
gemensam fjärdeposition .6)
Icke alkoholutlöst amnestiskt syndrom
(F04)
Postiktal amnesi vid epilepsi (G40.-)
F44.1
Dissociativ stupor
Dissociativ stupor diagnostiseras på basen
av uttalad minskning eller total frånvaro av
kroppsliga rörelser som normalt står under
viljans kontroll och normala reaktioner på
externa stimuli som ljus, ljud och beröring.
Undersökning och utredning ger inga bevis
för någon fysisk orsak. Däremot finns ofta
positiva tecken på psykologiska
orsaksfaktorer i form av nyligen
genomgånget trauma eller belastning.
Utesluter:
Organisk katatoni (F06.1)
Stupor:
• depressiv (F31-F33)
• kataton (F20.2)
• manisk (F30.2)
• UNS (R40.1)
F44.3
Transtillstånd och besatthet
Störningar med en övergående förlust av
känsla för personlig identitet och full
medvetenhet om omgivningen. Här ska bara
inkluderas transtillstånd som är ofrivilliga
eller oönskade och som uppträder utanför
religiöst eller kulturellt accepterade
situationer.
Dissociativ fugue
Utesluter:
Tillstånd förenade med:
• akuta eller övergående psykotiska
störningar (F23.-)
• intoxikation med psykoaktiva
substanser (F10-F19 med gemensam
fjärdeposition .0)
• organisk personlighetsstörning
(F07.0)
• postkontusionellt syndrom (F07.2)
• schizofreni (F20.-)
Dissociativ fugue har den dissociativa
amnesins samtliga kännetecken. Därutöver
tillkommer ett målmedvetet resande som
överskrider vad som är normalt för
patienten. Utöver total amnesi för
fugueperioden, ter sig patientens beteende
helt normalt för en oberoende observatör.
Utesluter:
Postiktal fugue vid epilepsi (G40.-)
F44.4
Dissociativ motorisk störning
Visar sig oftast som en oförmåga att röra
hela eller delar av en extremitet. Det kan
finnas likheter med nästan vilken form som
helst av ataxi, apraxi, akinesi, afoni,
dysartri, dyskinesi, krampanfall eller
förlamning.
Psykogen afoni
Psykogen dysfoni
198
F44.4A
Psykogen dysfoni/afoni
F44.4B
Psykogent betingad artikulationsstörning
F44.4W
Annan specificerad psykogen motorisk
störning
F44.5
Dissociativa kramper
F45.0
Dissociativa kramper kan i hög grad likna
epileptiska kramper vad beträffar rörelser,
medan tungbett, blåmärken pga fall och
urininkontinens är ovanliga. Medvetandet är
bevarat eller ersatt med ett tillstånd av
stupor eller trans.
F44.6
Ett syndrom som karakteriseras av multipla,
återkommande och föränderliga kroppsliga
symtom med en duration på minst två år. De
flesta patienter har en lång och komplicerad
anamnes med kontakter inom både
primärvård och specialistvård. Det finns
många negativa undersökningsresultat eller
fruktlösa explorativa operationer. Symtom
hänförs till alla delar av kroppen eller till
vilket organsystem som helst. Störningens
förlopp är kroniskt och fluktuerande och
ofta förenat med försämrade sociala,
interpersonella eller familjära relationer
och beteenden. Kortvariga tillstånd (mindre
än två år) och mindre omfattande
symtomatologi bör klassificeras som
odifferentierad somatoform störning (F45.1)
Briquets sjukdom
Multipel psykosomatisk sjukdom
Dissociativ anestesi
Anestesins utbredningsområde på huden har
ofta gränser som tydliggör dess samband
med patientens uppfattning om kroppsliga
funktioner snarare än medicinsk kunskap.
Det kan finnas selektiva bortfall av
sensoriska kvaliteter som inte går att förena
med neurologisk sjukdom. Känselförlusten
kan åtföljas av klagomål på parestesier.
Syn- och hörselförlust vid dissociativa
tillstånd är sällan total.
Psykogen dövhet
F44.7
F44.8
Utesluter:
Medveten simulering (Z76.5)
Blandade dissociativa syndrom
Kombination av störningar specificerade
under F44.0-F44.6
F45.1
Gansers syndrom
Multipel personlighet
Psykogen konfusion
Psykogent skymningstillstånd
Dissociativt syndrom, ospecificerat
F45
Somatoforma syndrom
Perturbationes somatoformes
Odifferentierat somatoformt syndrom
När multipla, varierande och ihållande
kroppsliga symtom föreligger men då den
kompletta och typiska kliniska bilden vid
somatoforma syndrom inte är uppfylld skall
diagnosen odifferentierad somatoform
störning övervägas.
Odifferentierad psykosomatisk sjukdom
Andra specificerade dissociativa
syndrom
F44.9
Somatiseringssyndrom
F45.2
Det främsta särdraget är återkommande
klagomål på kroppsliga symtom i förening
med upprepade krav på medicinska
undersökningar, trots tidigare negativa fynd
och försäkringar om att symtomen inte har
någon kroppslig orsak. Om det finns en
kroppslig sjukdom kan denna inte förklara
symtomens art eller omfattning och ej heller
patientens oro och fixering vid symtomen.
Utesluter:
Dissociativa syndrom (F44.-)
Dyslali (F80.0)
Hårryckning (F98.4)
Läspning (F80.8)
Nagelbitning (F98.8)
Psykologiska och beteendefaktorer med
betydelse för störningar eller sjukdomar
som klassificeras på annan plats (F54)
Tics (hos barn och ungdom) (F95.-)
Tourettes syndrom (F95.2)
Trikotillomani (F63.3)
Tumsugning (F98.8)
199
Hypokondri
Kännetecknas av en ständig upptagenhet
med möjligheten att ha en eller flera
allvarliga och progredierande kroppsliga
sjukdomar. Patienten klagar ständigt över
kroppsliga symtom eller är ständigt
upptagen av sitt utseende. Kroppens
normala eller vanliga signaler och
utseendemässiga varianter tolkas ofta av
patienten som abnorma eller skrämmande.
Uppmärksamheten är vanligen fokuserad på
ett eller två av kroppens organsystem. Sänkt
grundstämning och ångest är oftast
närvarande och kan motivera ytterligare
diagnoser.
Dysmorfofobi
Hypochondriasis
Hypokondrisk neuros
Nosofobi
Utesluter:
Dysmorfofobi av
vanföreställningskaraktär (F22.8)
Fixerade vanföreställningar om
kroppsfunktioner eller kroppsform
(F22.-)
F45.2A
Dysmorfofobi
F45.2B
Nosofobi
F45.2C
Cancerofobi
F45.2D
Venereofobi
F45.2X
Hypokondri, ospecificerad
F45.3
Somatoform autonom dysfunktion
F45.4
Symtom presenteras av patienten som om de
berodde på fysisk sjukdom i ett system eller
ett organ som helt eller delvis står under
autonom innervation och kontroll såsom
kardiovaskulära, gastrointestinala,
respiratoriska och urogenitala system.
Symtomen är vanligtvis av två typer, men
ingen av dessa tyder på någon kroppslig
sjukdom i det system eller organ som
symtomet hänförs till. Den ena symtomtypen
utgörs av objektiva tecken på ökad autonom
aktivitet såsom palpitationer, ökad svettning,
rodnad och skakningar samt uttryck för
fruktan och oro över möjligheten att ha
drabbats av en kroppslig sjukdom. Den
andra typen är subjektiva klagomål av
ospecifik eller föränderlig natur såsom
flyktiga smärtor, brännande känslor,
tyngdkänsla, stramhet och uppblåsthet, vilka
av patienten hänförs till ett specifikt
organsystem.
Da Costas syndrom
Hjärtneuros
Magneuros
Neurocirkulatorisk asteni
Psykogena former av:
• aerofagi
• diarré
• dyspepsi
• dysuri
• flatulens
• frekvent urinering
• hicka
• hosta
• hyperventilation
• irritabel tarm
• pylorospasm
Utesluter:
Psykologiska faktorer och
beteendefaktorer med betydelse för
störningar eller sjukdomar som
klassificeras på annan plats (F54)
200
Kroniskt somatoformt smärtsyndrom
Patientens huvudsakliga besvär är
ihållande, uttalade och störande smärtor
som inte kan förklaras till fullo med
fysiologiska processer eller fysisk sjukdom
och som förekommer tillsammans med
konflikter eller psykosociala problem som är
allvarliga nog att tillåta slutsatsen att dessa
har förorsakat tillståndet. Resultatet för
patienten blir ofta en markant ökning av
stöd och uppmärksamhet, endera personlig
eller medicinsk. Psykogent betingad smärta
som uppträder under förloppet av en
depressiv episod eller ett schizofrent
syndrom skall inte inkluderas här.
Psykalgi
Psykogen huvudvärk
Psykogen ryggvärk
Somatoformt smärttillstånd
Utesluter:
Ryggvärk UNS (M54.9)
Smärta:
• akut (R52.0)
• behandlingsresistent (R52.1)
• kronisk (R52.2)
• spänningshuvudvärk (G44.2)
• UNS (R52.9)
F45.8
Andra specificerade somatoforma
syndrom
Här klassificeras andra typer av störningar
som påverkar sensoriet, funktion eller
beteende, vilka inte beror på kroppslig
sjukdom, inte medieras via det autonoma
nervsystemet, är begränsade till specifika
system eller delar av kroppen och har nära
relation till belastande händelser eller
problem.
Bruxism
Psykogen:
• dysfagi, innefattande ”globus
hystericus”
• dysmenorré
• klåda
• tortikollis
F45.9
Somatoformt syndrom, ospecificerat
Psykosomatisk sjukdom UNS
F48
Andra neurotiska syndrom
F48.1
Aliae perturbationes neuroticae
F48.0
En ovanlig störning, där patienten påtalar
kvalitetsförskjutningar i sin mentala
aktivitet, kropp och omgivningar, som alla
har blivit overkliga, avlägsna eller
¨automatiserade¨. Bland syndromets många
och skiftande fenomen klagar patienten
oftast på förlust av känslor, en upplevelse av
främlingskap eller distans till sina egna
tankar, sin egen kropp eller omgivningen.
Trots upplevelsernas dramatiska karaktär är
patienten medveten om att någon verklig
förändring inte har skett. Sensoriet är
normalt och kapaciteten till känslomässiga
uttryck är intakt. Depersonalisationsderealisationssymtom kan förekomma som
delsymtom vid schizofreni, depression,
fobiska och obsessiva-kompulsiva tillstånd
och de ska då kodas enligt huvuddiagnosen.
Neurasteni
Denna störning uppvisar betydande
kulturella variationer. Två huvudtyper
förekommer och de överlappar varandra.
Vid den ena formen är det dominerande
symtomet klagomål på ökad uttröttbarhet
efter mental ansträngning, ofta i förening
med nedsatt arbetsprestation eller nedsatt
förmåga att utföra dagliga göromål. Den
mentala uttröttbarheten beskrivs oftast som
obehaglig påverkan av distraherande tankar
eller minnen, koncentrationssvårigheter och
ineffektivt tänkande. Vid den andra typen
ligger tyngdpunkten på kroppslig eller fysisk
svaghet och utmattning efter minimal
ansträngning. Detta åtföljs av
muskelsmärtor, muskelspänningar och
svårigheter att slappna av. Vid bägge
formerna finns en mängd andra obehagliga
förnimmelser såsom yrsel,
spänningshuvudvärk och osäkerhetskänslor.
Oro över minskat fysiskt och psykiskt
välbefinnande, irritabilitet, anhedoni och
olika grad av lättare nedstämdhet och
ångest är alla vanliga fenomen. Sömnen är
oftast störd i den initiala och mellersta fasen
men hypersomni kan också förekomma.
Trötthetssyndrom UNS
Tilläggskod kan användas för att identifiera
tidigare fysisk sjukdom
Utesluter:
Asteni UNS (R53)
Kroniskt trötthetssyndrom (G93.3)
Psykasteni (F48.8)
Sjukdomskänsla och trötthet (R53)
Trötthetssyndrom efter virusinfektion
(G93.3)
Utbrändhet (Z73.0)
Utmattningssyndrom (F43.8)
201
Depersonalisations- och
derealisationssyndrom
F48.8
Andra specificerade neurotiska
syndrom
Dhats syndrom
Psykasten neuros
Psykasteni
Psykogen synkope
Yrkesneuros, inkluderande skrivkramp
F48.9
Neurotiskt syndrom, ospecificerat
Neuros UNS
BETEENDESTÖRNINGAR FÖRENADE
MED FYSIOLOGISKA RUBBNINGAR
OCH FYSISKA FAKTORER (F50-F59)
F50.2
Syndromet karakteriseras av återkommande
hetsätningsepisoder samt överdriven
upptagenhet med viktkontroll som leder till
ett mönster av hetsätning som följs av
kräkning eller bruk av laxantia. Denna
störning delar många psykologiska faktorer
med anorexia nervosa, bl a en överdriven
oro för kroppens utseende och vikt.
Upprepade kräkningar medför ofta
elektrolytrubbningar och fysiska
komplikationer. Det finns ofta, dock ej alltid,
en anamnes på någon episod med anorexia
nervosa månader eller år tidigare.
Bulimi UNS
Hyperorexia nervosa
Syndromata morum e perturbationibus
physiologicis et factoribus physicis
F50
Ätstörningar
Perturbationes edendi
Ätbeteendestörning
Utesluter:
Anorexi UNS (R63.0)
Matvägran hos spädbarn och barn
(F98.2)
Polyfagi (R63.2)
Svårigheter med och misskötsel av
födointag (R63.3)
F50.0
F50.3
Utesluter:
Aptitförlust (R63.0)
Psykogen aptitförlust (F50.8)
F50.1
Atypisk anorexia nervosa
Störningar som uppfyller några av
kriterierna för anorexia nervosa men där
den samlade kliniska bilden inte helt
uppfyller vad som krävs för diagnos enligt
F50.0. Exempelvis kan något av
huvudsymtomen, såsom amenorré eller stark
rädsla för fetma, saknas trots kraftig
viktnedgång och viktreducerande beteende.
Denna diagnos skall inte ställas vid närvaro
av en fysisk sjukdom som medför viktförlust.
202
Atypisk bulimia nervosa
Här klassificeras ätstörningar som uppfyller
några av kriterierna för bulimia nervosa
men där den kliniska bilden som helhet inte
ger fog för diagnosen. Exempelvis kan det
förekomma episoder med hetsätning och
överförbrukning av laxermedel utan
signifikant viktförlust eller kan den typiska
överdrivna oron för figuren och vikten
saknas.
Anorexia nervosa
En störning som karakteriseras av avsiktlig
viktnedgång, framkallad och vidmakthållen
av patienten själv. Störningen uppträder
oftast hos tonårsflickor och yngre vuxna
kvinnor men även tonårspojkar och yngre
vuxna män kan drabbas, liksom barn strax
före puberteten och kvinnor fram till
menopaus. Störningen är kopplad till en
specifik psykopatologi, där förändrad
kroppsuppfattning dominerar. Rädslan för
fetma och övervikt blir en övervärdig idé
och patienten strävar efter en låg kroppsvikt.
Undernäring av varierande svårighetsgrad
förekommer ofta, med sekundära endokrina
och metaboliska rubbningar samt störda
kroppsfunktioner. Symtomen innefattar
inskränkt diet, excessiv fysisk aktivitet,
självframkallade kräkningar och
användning av avmagringsmedel,
laxermedel och diuretika.
Bulimia nervosa
F50.4
Överdrivet ätande sammanhängande
med andra psykiska störningar
Överdrivet ätande till följd av belastande
faktorer i omgivningen, såsom närståendes
död, olycka eller barnafödande.
Överdrivet ätande av psykogena orsaker
Utesluter:
Fetma (E66.-)
F50.5
Kräkningar sammanhängande med
andra psykiska störningar
Upprepade kräkningar som förekommer vid
dissociativa tillstånd (F44.-) och hypokondri
(F45.2) och som inte helt kan förklaras med
somatiska tillstånd. Denna subkategori kan
även användas för dubbelkodning
tillsammans med O21.- (Ihållande
kräkningar under graviditeten) när
emotionella faktorer är den främsta orsaken
till återkommande illamående och kräkning
under graviditeten.
Psykogena kräkningar
Utesluter:
Illamående (R11)
Kräkning UNS (R11)
F50.8
F51.1
Andra specificerade ätstörningar
Picasyndrom hos vuxna
Psykogen aptitförlust
Hypersomni definieras som ett tillstånd med
endera ökad dagtrötthet och sömnattacker
(som inte beror på sömnbrist) eller förlängd
övergångsperiod mellan uppvaknandet och
full vakenhet. När tillståndet inte har
organisk orsak är det vanligen associerat
med psykisk sjukdom.
Utesluter:
Picasyndrom hos spädbarn och barn
(F98.3)
F50.9
F51
Ätstörning, ospecificerad
Utesluter:
Narkolepsi (G47.4)
Organisk hypersomni (G47.1)
Icke organiska sömnstörningar
Perturbationes somni non
organicae
F51.2
Sömnstörning är ett vanligt symtom vid
andra sjukdomar, både psykiska och fysiska.
Om en sömnstörning hos en viss patient
skall betraktas som ett oberoende tillstånd
eller som ett symtom på en sjukdom som
klassificeras på annan plats avgörs av
klinisk bild, förlopp samt av terapeutiska
överväganden och terapeutiska
prioriteringar vid konsultationen. Om
sömnstörningen är ett av patientens största
problem och om den uppfattas som ett
oberoende tillstånd skall i allmänhet denna
kod användas, eventuellt tillsammans med
andra passande diagnoser som täcker övrig
psykopatologi och patofysiologi hos den
enskilda patienten. Detta avsnitt omfattar
bara sådana sömnstörningar som primärt
har emotionella orsaker och inte beror på
identifierbara fysiska tillstånd som
klassificeras på annan plats.
Utesluter:
Organisk störning i dygnsrytmen (G47.2)
F51.3
Utesluter:
Organisk sömnlöshet (G47.0)
203
Sömngång [somnambulism]
Somnambulism eller sömngång är ett
tillstånd med förändrad medvetenhet där
fenomen både från sömn och vakenhet ingår.
Under en sömngångsepisod stiger individen
upp från sängen, vanligtvis under
nattsömnens första tredjedel, och vandrar
omkring med sänkt uppmärksamhetsgrad,
förlångsammad reaktionsförmåga och
försämrade motoriska färdigheter. Vid
uppvaknandet märks ofta amnesi för
perioden.
Icke organisk sömnlöshet
Ett tillstånd med otillfredsställande kvalitet
eller kvantitet på sömnen under en längre
tid. Sömnstörningen innefattar
insomningssvårigheter, avbruten sömn och
tidigt morgonuppvaknande. Insomnia är ett
vanligt symtom vid många psykiska och
fysiska sjukdomar och får kodas här,
förutom till den underliggande sjukdomen,
bara om insomnia dominerar den kliniska
bilden.
Icke organisk störning i dygnsrytmen
Störd sömn-vakenhetsrytm, definierad som
bristande överensstämmelse mellan
patientens egen och omgivningens
sedvanliga rytm för sömn/vakenhet. Detta
resulterar i klagomål på endera insomnia
eller hypersomnia.
Psykogent omvänd circadisk dygnsrytm
Psykogent omvänd sömnrytm
Utesluter:
Organiska sömnstörningar (G47.-)
F51.0
Icke organisk hypersomni
F51.4
Nattskräck
Tillståndet kan betraktas som en extrem
form av sömngångeri och visar sig som
nattliga episoder med uttalad rädsla och
panikångest med skrik, motorisk oro och
autonom hyperaktivitet. Individen sätter sig
upp eller går upp, vanligtvis under första
tredjedelen av nattsömnen, paniskt
skrikande. Ofta rusar individen till dörren
som för att försöka fly men lämnar sällan
rummet. Minnesbilder för händelsen är ofta
begränsade (vanligtvis ett eller två
minnesfragment).
F51.5
Mardrömmar
F52.2
Drömupplevelser laddade med ångest och
skräck och med detaljerade minnen av
dröminnehållet. Drömupplevelserna är
mycket livliga och innehåller ofta teman där
överlevnad, säkerhet och självkänsla är
hotade. Ofta återkommer samma eller
liknande teman i mardrömmarna. Under en
typisk episod finns en viss grad av autonom
hyperaktivitet men inga våldsamma rop eller
motorisk oro. Vid uppvaknandet blir
patienten snabbt klar och orienterad.
Ångestdrömmar
F51.8
Andra specificerade icke organiska
sömnstörningar
F51.9
Icke organisk sömnstörning,
ospecificerad
Emotionell sömnstörning UNS
F52
Sexuell dysfunktion, ej orsakad
av organisk störning eller
sjukdom
Huvudproblemet för män är erektil
dysfunktion (svårigheter att utveckla eller
upprätthålla tillräcklig erektion för att
genomföra ett adekvat samlag). Hos kvinnor
visar sig tillståndet som vaginal torrhet eller
minskad genital lubrikation i samband med
sexuell aktivitet.
Psykogen impotens
Utesluter:
Impotens av organisk orsak (N48.4)
F52.3
Orgasmstörning
F52.4
Prematur ejakulation
F52.5
Utesluter:
Vaginism (organisk) (N94.2)
F52.6
Nedsatt libido
Sexuell aversion och avsaknad av
sexuell njutning
Antingen medför tanken på sexuell aktivitet
så mycket obehag, fruktan eller ångest att
sexuella aktiviteter undviks (sexuell
aversion) eller är de sexuella reaktionerna
normala med förmåga till orgasm men
normala lustkänslor saknas (brist på sexuell
njutning).
Sexuell anhedoni
204
Icke organisk dyspareuni
Dyspareuni (smärtor vid samlag) kan
uppträda hos både män och kvinnor. Detta
kan oftast hänföras till lokal patologi och
skall då kodas under respektive patologiskt
tillstånd. Denna kategori skall bara
användas i avsaknad av någon primär, icke
organisk sexuell dysfunktion som vaginism
eller vaginal torrhet.
Psykogen dyspareuni
Huvudproblemet är avsaknad av eller
nedsatt sexuell lust och detta är inte
sekundärt till andra sexuella problem såsom
erektil dysfunktion eller dyspareuni.
Frigiditet
Hypoaktiv störning av sexuell lust
F52.1
Icke organisk vaginism
Spasm i bäckenmuskulaturen som omger
vagina vilket omöjliggör eller försvårar
införandet av penis.
Psykogen vaginism
Utesluter:
Dhats syndrom (F48.8)
F52.0
Utebliven orgasm eller orgasm som är
markant fördröjd.
Hämmad orgasm (kvinnlig, manlig)
Psykogen anorgasmi
Oförmåga att kontrollera
ejakulationsreflexen tillräckligt länge för att
tillfredsställa båda parter.
Dysfunctio sexualis, a
perturbatione organica sive
morbo organico non provocata
Sexuella dysfunktioner omfattar en rad
tillstånd där en individ är oförmögen till
önskad sexuell aktivitet. Det sexuella
gensvaret är en psykosomatisk process och
både psykologiska och somatiska faktorer är
oftast orsak till sexuell dysfunktion.
Uteblivet genitalt gensvar
Utesluter:
Dyspareuni (organisk) (N94.1)
F52.7
Överdriven sexualdrift
F52.8
Andra specificerade sexuella
dysfunktioner, ej orsakade av
organisk störning eller sjukdom
F52.9
Ospecificerad sexuell dysfunktion, ej
orsakad av organisk störning eller
sjukdom
Nymfomani
Satyriasis
F53
Psykiska störningar och
beteendestörningar
sammanhängande med
barnsängstiden, vilka ej
klassificeras på annan plats
F54
Perturbationes mentis et morum
ad puerperium pertinentes, non
alibi classificatae
Här klassificeras bara psykiska störningar
associerade med puerperiet (med debut
inom 6 veckor efter förlossningen) som inte
uppfyller kriterierna för störningar
klassificerade på andra ställen i detta
kapitel. Detta kan bero på ofullständig
information eller på speciella kliniska drag
som omöjliggör klassifikation på annan
plats.
F53.0
Lindriga psykiska störningar och
beteendestörningar sammanhängande
med barnsängstiden, vilka ej
klassificeras på annan plats
Postpartum-depression UNS
Puerperal depression UNS
F53.1
Svåra psykiska störningar och
beteendestörningar sammanhängande
med barnsängstiden, vilka ej
klassificeras på annan plats
Puerperal psykos UNS
F53.8
F53.9
Andra specificerade psykiska
störningar och beteendestörningar
sammanhängande med
barnsängstiden, vilka ej klassificeras
på annan plats
Psykisk störning, ospecificerad,
sammanhängande med
barnsängstiden
205
Psykologiska faktorer och
beteendefaktorer med
betydelse för störningar eller
sjukdomar som klassificeras
på annan plats
Factores mentales et factores
morum ad perturbationes sive
morbos alibi classificatos
pertinentes
Denna kategori skall användas när
psykologiska eller beteendemässiga faktorer
antas ha spelat en väsentlig roll för etiologin
av en somatisk sjukdom som kan
klassificeras till andra kapitel. De psykiska
symtom som eventuellt kommer till uttryck
(oro, konflikter, bekymmer) är milda, ofta
långdragna och motiverar inte i sig själva
användandet av andra kategorier ur detta
kapitel.
Psykologiska faktorer som påverkar
kroppsliga tillstånd
Exempel på användning av kategorin är:
• astma F54 och J45.• colon irritabile F54 och K58.• dermatit F54 och L23-L25
• irritable bowel syndrome [IBS] F54
och K58.• magsår F54 och K25.• ulcerös kolit F54 och K51.• urtikaria F54 och L50.Tilläggskod kan användas för att ange
associerad kroppslig störning
Utesluter:
Spänningshuvudvärk (G44.2)
F55
Missbruk av substanser som ej
är beroendeframkallande
Abusus substantiarum non
addictivarum
Omfattar en stor mängd medikamenter och
folkmediciner där de viktigaste grupperna är
a) icke beroendeframkallande psykotropa
farmaka, t ex antidepressiva läkemedel, b)
laxantia, c) icke receptbelagda analgetika
såsom salicylater och paracetamol.
Stadigvarande bruk av dessa substanser
leder ofta till onödiga kontakter med läkare
eller annan vårdpersonal och kan ibland ge
upphov till fysiska skador. Försök att avråda
ifrån eller förbjuda bruket möts ofta med
motstånd, trots upplysningar och eventuella
fysiska skador såsom njurpåverkan eller
elektrolytrubbningar. Trots att patienten
uppenbarligen är starkt motiverad att ta
substansen uppstår varken beroende eller
abstinenssymtom av den typ som ses vid
bruk av de psykoaktiva substanser som
specificeras under F10-F19.
Missbruk av:
• antacida
• laxermedel
• paracetamol
• salicylater
• steroider eller hormoner
• vitaminer
• örter eller folkmediciner
Perturbationes personalitatis et
perturbationes morum adultorum
Detta avsnitt omfattar en rad störningar och
beteendemönster av klinisk signifikans som ofta blir
varaktiga och som framstår som ett uttryck för patientens
karakteristiska livsstil och hållning till sig själv och
andra. Några av dessa störningar och beteendemönster
uppstår tidigt i individens utveckling och är resultatet av
såväl konstitutionella faktorer som miljöpåverkan medan
andra utvecklas senare i livet. Specifika
personlighetsstörningar (F60.-), personlighetsstörningar
av blandtyp och andra personlighetsstörningar (F61.-)
och icke organiska personlighetsstörningar (F62.-) är
djupt genomgripande och varaktiga beteendemönster
som manifesterar sig som onyanserade reaktioner på en
mängd personliga och sociala situationer. De
representerar extrema eller betydande avvikelser från hur
genomsnittsmänniskan agerar i en viss kulturell
omgivning, både tankemässigt, känslomässigt och
särskilt relationsmässigt. Dessa beteendemönster är
oftast stabila och omfattar många beteendefunktioner och
psykologiska funktioner. De är ofta, men inte alltid,
förenade med olika grader av subjektivt lidande och
nedsatt social funktionsförmåga.
F60
Specifika
personlighetsstörningar
Perturbationes personalitatis
specificae
Utesluter:
Missbruk av psykoaktiva substanser
(F10-F19)
F59
PERSONLIGHETSSTÖRNINGAR OCH
BETEENDESTÖRNINGAR HOS VUXNA
(F60-F69)
Ospecificerade
beteendesyndrom förenade
med fysiologiska störningar
och fysiska faktorer
Syndromata morum non
specificata cum perturbationibus
physiologicis et factoribus
physicis
Psykogen fysiologisk dysfunktion UNS
206
Dessa är uttalade störningar i individens
personlighetsstruktur och beteendemönster.
De är inte ett direkt resultat av
hjärnsjukdom, hjärnskada eller andra
hjärnaffektioner och ej heller av andra
psykiatriska åkommor. Störningarna
påverkar åtskilliga områden av
personligheten och är nästan alltid
förbundna med subjektivt obehag och
sociala svårigheter. De manifesterar sig
oftast i barndomen eller tonåren och
fortsätter genom vuxenåldern.
F60.0
F60.2
Paranoid personlighetsstörning
En personlighetsstörning som karakteriseras
av extrem känslighet för misslyckanden och
avvisningar, oförmåga att förlåta
förolämpningar, misstänksamhet med en
tendens att misstolka neutrala eller vänliga
handlingar som fientliga eller
nedvärderande, återkommande grundlösa
misstankar om att partnern är otrogen och
ivrigt försvar av egna rättigheter. Det kan
finnas en överdriven föreställning om sin
egen betydelse och roll som normgivare.
Personlighetsstörning:
• expansiv paranoid
• fanatisk
• kverulantisk
• paranoid
• sensitiv paranoid
En personlighetsstörning som karakteriseras
av bristande hänsynstagande till sociala
förpliktelser och andra människors känslor.
Det finns en stor diskrepans mellan beteende
och rådande sociala normer. Beteendet
modifieras knappast av obehagliga
erfarenheter, inklusive straff.
Frustrationströskeln är låg och detsamma
gäller tröskeln för aggression, inklusive
våldshandlingar. Det finns en tendens att
skylla på andra eller att bortförklara
beteenden som leder till konflikt med
samhället genom trovärdiga
rationaliseringar.
Personlighetsstörning:
• amoralisk
• antisocial
• asocial
• psykopatisk
• sociopatisk
Utesluter:
Paranoia (F22.0)
Paranoia querulans (F22.8)
Paranoid psykos (F22.0)
Paranoid schizofreni (F20.0)
Paranoida tillstånd (F22.0)
F60.1
Antisocial personlighetsstörning
Utesluter:
Beteendestörningar av utagerande slag
(F91.-)
Emotionellt instabil
personlighetsstörning (F60.3)
Schizoid personlighetsstörning
En personlighetsstörning som karakteriseras
av tillbakadragenhet från känslomässiga,
sociala eller andra medmänskliga kontakter
men med en förkärlek för fantasi, ensamma
aktiviteter och introspektion. Det finns en
nedsatt förmåga att uttrycka känslor och
uppleva glädje.
Utesluter:
Aspergers syndrom (F84.5)
Schizofreni (F20.-)
Schizoid störning i barndomen (F84.5)
Schizotyp störning (F21)
Vanföreställningssyndrom (F22.0)
F60.3
Emotionellt instabil
personlighetsstörning
En personlighetsstörning som karakteriseras
av en uttalad tendens att agera impulsivt och
utan att betänka eventuella konsekvenser.
Humöret är oberäkneligt och föränderligt.
Det är vanligt med affektutbrott och en
oförmåga att kontrollera de våldsamma
reaktionerna. Det finns en tendens till
grälsjukt och konfliktsökande beteende,
speciellt då impulsiva handlingar bromsas
eller hindras. Två typer av
personlighetsstörningen kan urskiljas: den
impulsiva typen som främst karakteriseras
av emotionell instabilitet och brist på
impulskontroll och borderlinetypen som
karakteriseras av osäkerhet vad beträffar
självuppfattning, livsmål och inre val, en
kronisk känsla av inre tomhet, intensiva och
instabila interpersonella relationer samt en
tendens till självdestruktivt beteende
inklusive suicidhandlingar och suicidförsök.
Personlighetsstörning:
• aggressiv
• borderline
• explosiv
Utesluter:
Antisocial personlighetstörning (F60.2)
207
F60.4
Histrionisk personlighetsstörning
F60.8
En personlighetsstörning som karakteriseras
av överdrivna och labila affekter, en tendens
att dramatisera, teatraliskt uppträdande och
överdrivna känslouttryck. Individerna är
lättpåverkade, egocentriska, njutningslystna,
lättsårade, uppvisar bristande omtanke om
andra, och söker ständigt beröm, spänning
och uppmärksamhet
Hysterisk personlighetsstörning
Psykoinfantil personlighetsstörning
F60.5
F60.6
Ängslig personlighetsstörning
En personlighetsstörning som karakteriseras
av känslor av spänning, ängslighet,
osäkerhet och mindervärdighet. Det finns en
ständig önskan att vara omtyckt och
accepterad, en överkänslighet för
avvisningar och kritik samt begränsningar i
kontakten med andra människor. Dessutom
finns en tendens att undvika vissa aktiviteter
genom att överdriva möjliga faror eller
risker i vardagssituationer.
F60.7
Personlighetsstörning:
• excentrisk
• narcissistisk
• omogen
• passiv-aggressiv
• psykoneurotisk
F60.9
Personlighetsstörning, ospecificerad
F61
Personlighetsstörningar av
blandtyp och andra
personlighetsstörningar
Anankastisk personlighetsstörning
En personlighetsstörning som karakteriseras
av känslor av tvivel, perfektionism, och
överdriven noggrannhet. Individerna är
kontrollerande och upptagna med detaljer,
istadiga, försiktiga och rigida. Det kan
uppträda påträngande och ovälkomna
tankar eller impulser men inte i lika hög
grad som vid obsessivt-kompulsivt syndrom.
Personlighetsstörning:
• kompulsiv
• obsessiv
• obsessiv-kompulsiv
Utesluter:
Tvångssyndrom (F42.-)
Osjälvständig personlighetsstörning
En personlighetsstörning som karakteriseras
ev. ett uttalat passivt överlåtande på andra
människor av ansvaret för att fatta både små
och stora beslut, stor oro för att bli
övergiven, känslor av hjälplöshet och
inkompetens, passiv eftergivlighet för andras
önskningar och förväntningar samt
svårigheter att motsvara vardagens krav.
Bristen på livskraft kan visa sig både
intellektuellt och emotionellt och det finns
ofta en tendens att överlåta ansvar på andra
människor.
Personlighetsstörning:
• astenisk
• inadekvat
• passiv
• självdestruktiv
208
Andra specificerade
personlighetsstörningar
Karaktärsneuros UNS
Patologisk personlighet UNS
Perturbationes mixtae
personalitatis et aliae
perturbationes personalitatis
Denna kategori är avsedd för
personlighetsstörningar av klinisk betydelse
som inte uppvisar de speciella drag eller
symtom som karakteriserar tillstånden
beskrivna under F 60.-. Detta resulterar i att
de ofta är svårare att diagnostisera än
tillstånden under F60.-. Exempel på tillstånd
som ryms här: Blandade
personlighetsstörningar med drag från flera
av de tillstånd som beskrivs under F60.- men
utan framträdande mönster som skulle
berättiga till en mer specifik diagnos.
Kliniskt betydande
personlighetsförändringar, ej
klassificerbara under F60.- eller F62.- och
som kan betraktas som sekundära till
samtidig förekomst av affektivt syndrom
eller ångestsyndrom.
Utesluter:
Accentuerade personlighetsdrag (Z73.1)
F62
Kroniska personlighetsförändringar ej orsakade av
hjärnskada eller hjärnsjukdom
F62.1
Bestående personlighetsförändringar, med
minst två års varaktighet, som kan förklaras
av den traumatiska belastningen som
genomgången allvarlig psykisk sjukdom
innebär. Förändringen kan inte förklaras
med tidigare personlighetsstörning och skall
skiljas från residualschizofreni och andra
tillstånd med ofullständigt tillfrisknande från
en allvarlig psykisk sjukdom. Störningen
karakteriseras av ett överdrivet beroende av
och krav gentemot andra; en övertygelse om
att vara förändrad eller stigmatiserad av
sjukdomen, vilket leder till oförmåga att
etablera och vidmakthålla nära och
förtroliga personliga relationer och till
social isolering; passivitet, inskränkta
intressen och bristande engagemang i
fritidsaktiviteter; ständiga klagomål på att
vara sjuk, vilket kan vara förenat med
hypokondriska påståenden och
sjukdomsbeteende; dysforiskt eller labilt
humör som inte beror på aktuell psykisk
störning eller residualsymtom; samt
långvariga problem i sociala sammanhang
och i arbetslivet.
Commutationes personalitatis
chronicae, non a laesione sive
morbo cerebri provocatae
Varaktig förändring av vuxen personlighet
och vuxet beteende som har uppstått hos
personer med icke tidigare existerade
personlighetsstörning, till följd av katastrof
eller långvarig stress eller efter allvarlig
psykisk sjukdom. Denna diagnos skall bara
ställas när det finns bevis på säker och
bestående förändring i en persons sätt att
uppfatta eller förhålla sig till omgivningen
och sig själv. Personlighetsförändringen
skall vara signifikant och vara förenad med
inflexibilitet och maladaptivt beteende som
inte fanns före den patogenetiska händelsen.
Förändringen skall inte vara en direkt
manifestation av andra psykiska sjukdomar
eller vara residualsymtom från en
genomgången psykisk sjukdom.
Utesluter:
Personlighets- och beteendestörningar
orsakade av hjärnsjukdom, hjärnskada
och cerebral dysfunktion (F07.-)
F62.0
Varaktig personlighetsförändring till
följd av katastrofupplevelse
Bestående personlighetsförändringar, med
minst två års varaktighet, som uppstått efter
katastrofal belastning. Stressen skall ha
varit så uttalad att personlig vulnerabilitet
inte kan komma i fråga som förklaring till
personlighetsförändringen. Tillståndet
karakteriseras av en fientlig eller misstrogen
attityd mot omvärlden, en social
tillbakadragenhet, känslor av tomhet eller
hopplöshet, en kronisk känsla av att vara
ständigt hotad samt en främlingskänsla.
Posttraumatiskt stressyndrom (F43.1) kan
föregå denna typ av
personlighetsförändring.
Personlighetsförändring efter:
• katastrof
• koncentrationslägerupplevelser
• långdragen:
• exponering för livshotande
situationer såsom att vara offer
för terrorism eller tortyr
• fångenskap med överhängande
risk att bli dödad
Utesluter:
Posttraumatiskt stressyndrom (F43.1)
209
Varaktig personlighetsförändring till
följd av psykisk sjukdom
F62.8
Andra specificerade varaktiga
personlighetsförändringar
F62.9
Varaktig personlighetsförändring,
ospecificerad
Personlighetsförändring vid kronisk
smärta
F63
Impulskontrollstörningar
Perturbationes continentiae
impulsuum
Denna kategori innefattar vissa
beteendestörningar som inte klassificeras
under andra kategorier. De karakteriseras
av upprepade handlingar som inte har
några rationella motiv, inte kan kontrolleras
och som vanligtvis skadar patientens egna
samt andras intressen. Patienten säger att
beteendet styrs av impulser som inte går att
behärska. Störningarnas genes är inte
klarlagd och de är grupperade tillsammans
på grund av sina yttre likheter snarare än på
grund av några mera fundamentala
gemensamma drag.
Utesluter:
Impulsstörning av sexuellt beteende
(F65.-)
Vanemässigt missbruk av alkohol eller
psykoaktiva substanser (F10-F19)
F63.0
Spelberoende
F63.3
En störning som karakteriseras av en
betydande hårförlust till följd av en ständig
oförmåga att motstå impulser att dra bort
hårstrån. Hårdragningen föregås ofta av
stigande spänning och åtföljs av en känsla
av lättnad och tillfredsställelse. Diagnosen
skall inte ställas om hårdragningen föregås
av hudinflammationer eller beror på
vanföreställningar eller hallucinationer.
Karakteriseras av frekventa och upprepade
spelepisoder som dominerar patientens liv
på bekostnad av sociala, arbetsmässiga eller
familjemässiga förpliktelser.
Kompulsivt spelberoende
Utesluter:
Spel och vadslagning UNS (Z72.6)
Spel vid antisocial personlighet (F60.2)
Överdrivet spelande hos maniska
patienter (F30.-)
F63.1
Utesluter:
Pyromandåd vid:
• antisocial personlighetsstörning hos
vuxen (F60.2)
• beteendestörning (F91.-)
• intoxikation med alkohol eller
psykoaktiva substanser (F10-F19),
med gemensam fjärdeposition .0)
• organiska psykiska störningar (F00F09)
• schizofreni (F20.-)
Pyromandåd som orsak till observation
för misstänkt psykisk störning (Z03.2)
F63.2
Utesluter:
Rörelsestereotypi med hårryckning
(F98.4)
Pyromani
En störning som karakteriseras av multipla
försök att tända eld på egendom eller
föremål utan tydligt motiv samt av en
upptagenhet med föremål som är relaterade
till eld och brand. Beteendet är ofta
associerat med en känsla av ökad spänning
före akten samt intensiv upphetsning
omedelbart efteråt.
F63.8
Utesluter:
Depressiv störning med stölder (F31F33)
Organisk psykisk störning (F00-F09)
Snatteri som orsak till observation för
misstänkt psykisk störning (Z03.2)
F63.9
Impulskontrollstörning, ospecificerad
F64
Könsidentitetsstörningar
Perturbationes identitatis sexus
F64.0
Transsexualism
En önskan om att leva och bli accepterad
som en medlem av det motsatta könet, ofta
åtföljt av en känsla av obehag eller
otillräcklighet med det egna anatomiska
könet och en önskan om hormonell eller
kirurgisk behandling för att kroppsligen
likna det prefererade könet så mycket som
möjligt.
F64.8
Andra specificerade
könsidentitetsstörningar
Utesluter:
Egodyston sexuell orientering (F66.1)
Störning i sexuell mognad (F66.0)
F64.9
210
Andra specificerade
impulskontrollstörningar
Andra former av långvarigt, repetitivt,
maladaptivt beteende som inte är sekundära
till allmänt vedertagna psykiatriska syndrom
och där patienten ideligen misslyckas med
att motstå impulser att utföra det aktuella
beteendet. Det finns en prodromalfas av
spänning samt en känsla av lättnad under
akten.
Intermittent explosivitet
Kleptomani
En störning som karakteriseras av
upprepade misslyckanden att stå emot
impulser att stjäla föremål som inte tillgrips
för vinning eller personligt bruk. I stället
kan de tillgripna föremålen kastas eller ges
bort eller gömmas undan. Beteendet är
vanligtvis associerat med en ökad känsla av
spänning före akten samt en känsla av
tillfredsställelse under och omedelbart efter
akten.
Trikotillomani
Könsidentitetsstörning, ospecificerad
Könsrollsstörning UNS
F65
Störningar av sexuell preferens
Perturbationes praeferentiae
sexualis
F66.0
Patienten lider av osäkerhet kring den
könsliga identiteten eller orienteringen,
vilket orsakar ångest eller depression.
Störningen är vanligast i adolescensen hos
individer som känner osäkerhet om huruvida
den egna orienteringen är homosexuell,
heterosexuell eller bisexuell. Den kan också
uppträda hos vuxna som efter en lång period
med till synes stabil sexuell orientering
upplever en förändring av den sexuella
orienteringen.
Innefattar:
Parafili
F65.2
Exhibitionism
En återkommande eller ständigt
förekommande önskan att visa könsorganen
för främlingar (oftast personer av motsatt
kön) eller för människor på offentliga
platser, utan inviter till närmare kontakt.
Handlingen är ofta, men inte alltid,
ledsagad av sexuell upphetsning och
efterföljes vanligen av masturbation.
F65.3
F65.4
F66.1
Pedofili
F66.2
Andra specificerade störningar av
sexuell preferens
Här klassificeras en rad andra sexuella
preferenser och aktiviteter, bl a att ringa
obscena telefonsamtal, gnugga sig mot
andra personer i folksamlingar för att uppnå
sexuell njutning, sexuell aktivitet med djur
och strypning eller anoxi för att förhöja
sexuell njutning.
Frotteurism
Nekrofili
F65.9
F66.8
Andra specificerade störningar av
psykosexuell utveckling
F66.9
Störning av psykosexuell utveckling,
ospecificerad
F68
Andra störningar av
personlighet och beteende hos
vuxna
Aliae perturbationes
personalitatis et morum
adultorum
F68.0
Förstärkning av kroppsliga symtom
av psykologiska skäl
Störning av sexuell preferens,
ospecificerad
Sexuell avvikelse UNS
F66
Störning av sexuella relationer
Könsidentiteten eller könsorienteringen
(heterosexuell, homosexuell eller bisexuell)
är orsak till svårigheter att uppnå och
vidmakthålla ett förhållande med en
sexualpartner.
Sexuell preferens för barn, pojkar, flickor
eller båda, vanligen prepubertala eller i
tidig pubertet.
F65.8
Egodyston sexuell orientering
Karakteriseras av att personen inte tvivlar
på sin könsidentitet eller könsorientering
(heterosexuell, homosexuell, bisexuell eller
prepubertal) men önskar att den var av
annat slag, då läggningen är förbunden med
psykologiska och beteendemässiga problem.
Eventuellt söker patienten behandling för att
få orienteringen ändrad.
Voyeurism
En återkommande eller ständig önskan att
titta på andra människors sexuella
aktiviteter eller avklädning. Handlingen sker
utan de iakttagnas vetskap och leder oftast
till sexuell upphetsning och masturbation.
Störning i sexuell mognad
Psykiska störningar och
beteendestörningar
sammanhängande med sexuell
utveckling och orientering
Perturbationes mentis et morum
ad evolutionem et orientationem
sexualem pertinentes
Anmärkning:
Den sexuella orienteringen i sig själv är
inte att betrakta som en psykisk störning.
211
Somatiska symtom som är förenliga med och
ursprungligen uppkomna till följd av en
diagnostiserad fysisk sjukdom eller tillstånd
men som förstärks eller förlängs på grund
av patientens psykiska tillstånd. Patienten är
ofta besvärad av kroppsliga smärtor eller
invaliditet och är upptagen av (kanske
berättigad) oro för försämring eller kronisk
utveckling.
Kompensationsneuros
Ränteneuros
F68.1
Medveten självskada eller simulering
av fysiska eller psykiska symtom
PSYKISK UTVECKLINGSSTÖRNING
(F70-F79)
Patienten simulerar ideligen symtom utan
synbar orsak och kan ibland skada sig själv
för att åstadkomma symtom eller
sjukdomstecken. Motivet är oklart och
förmodligen internt genererat i syfte att anta
en sjukroll. Tillståndet är ofta kombinerat
med störd personlighet och störda
relationer.
Münchhausens syndrom
Patomimi med kroppsliga eller psykiska
symtom
Vandrande patient
Retardatio mentalis
Utesluter:
Dermatitis factitia (L98.1)
Person som simulerar sjukdom (med
uppenbar motivering) (Z76.5)
F68.8
Andra specificerade störningar av
personlighet och beteende hos vuxna
Karaktärsstörning UNS
Relationsstörning UNS
F69
Ospecificerad störning av
personlighet och beteende hos
vuxna
Perturbatio personalitatis et
morum adultorum non specificata
Ett tillstånd med fördröjd eller inkomplett utveckling av
förståndet som främst karakteriseras av en nedsättning av
de färdigheter som mognar under utvecklingstiden och
som bidrar till den generella intelligensnivån, såsom
kognition, språk, motorik och sociala färdigheter.
Utvecklingsstörning kan föreligga med eller utan andra
psykiska eller fysiska tillstånd.
Det är brukligt att mäta graden av psykisk
utvecklingsstörning med standardiserade intelligenstest.
Dessa kan kompletteras med skalor för att bedöma social
adaptation i en viss omgivning. Dessa mätmetoder ger
approximativ indikation på nivån av psykisk
utvecklingsstörning. Diagnosen förutsätter även en
helhetsbedömning av den intellektuella funktionsnivån,
utförd av en erfaren diagnostiker.
Intellektuell förmåga och social anpassning kan
förändras över tid och kan förbättras genom träning och
rehabilitering, oavsett individens funktionsnivå.
Diagnoserna ska ställas på aktuell funktionsnivå.
Följande fjärdepositionsindelningar skall användas
för kategorierna F70-F79 för att identifiera graden av
beteendestörning.
.0 Med uppgift om ingen eller minimal
beteendestörning
.1 Betydande beteendestörning som kräver vård eller
behandling
.8 Andra beteendestörningar
.9 Utan uppgift om beteendestörning
Tilläggskod kan användas för att identifiera associerade
tillstånd såsom autism, andra utvecklingsstörningar,
epilepsi, beteendestörningar eller svårt fysiskt
handikapp.
F70
Lindrig psykisk
utvecklingsstörning
Retardatio mentalis levis
IQ i området 50-69 (hos vuxna mental ålder
från 9 till under 12 år). Medför vanligen
inlärningssvårigheter i skolan. Många vuxna
kan arbeta, upprätthålla goda sociala
relationer och bidra till samhället.
212
F71
F72
Medelsvår psykisk
utvecklingsstörning
STÖRNINGAR AV PSYKISK
UTVECKLING (F80-F89)
Retardatio mentalis media
Perturbationes progressionis mentalis
IQ i området 35-49 (hos vuxna mental ålder
från 6 år till under 9 år). Resulterar i
uttalad utvecklingsstörning i barndomen
men de flesta kan lära sig en viss grad av
oberoende i att klara personliga behov och
förvärva adekvata
kommunikationsfärdigheter och
skolfärdigheter. Vuxna kommer att behöva
varierande grad av stöd för att kunna bo och
arbeta i samhället.
Störningarna som är samlade i detta avsnitt har
gemensamt a) debut i barndom b) försämrad eller
försenad utveckling av funktioner som är nära knutna till
de biologiska mognadsprocesserna i centrala
nervsystemet samt c) ett kontinuerligt förlopp utan
remissioner eller återfall. I de flesta fall är det språkliga
funktioner, visuo-spatiala färdigheter och motorisk
koordination som berörs. Oftast finns den försenade eller
försämrade förmågan redan vid det tidigaste skedet i
utvecklingen då störningen går att påvisa. Den kommer
oftast att avta allteftersom barnet växer, även om
lindrigare defekter ofta kan bestå upp i vuxen ålder.
Svår psykisk
utvecklingsstörning
F80
Retardatio mentalis gravis
IQ i området 20-34 (hos vuxna, mental ålder
från 3 till 6 år). Behöver sannolikt ständigt
stöd och hjälp.
F73
Grav psykisk
utvecklingsstörning
Retardatio mentalis profunda
IQ under 20 (hos vuxna, mental ålder under
3 år). Kan inte klara personliga behov,
kontinens, kommunikation eller mobilitet.
F78
Annan psykisk
utvecklingsstörning
Alia retardatio mentalis
F79
Ospecificerad psykisk
utvecklingsstörning
Retardatio mentalis non
specificata
F79.9A
Talsvårigheter hos utvecklingsstörd,
artikulation
F79.9B
Talsvårigheter hos utvecklingsstörd,
språk
F79.9X
Ospecificerade talsvårigheter hos
utvecklingsstörd
213
Specifika störningar av tal- och
språkutvecklingen
Perturbationes specificae
progressionis linguae et sermonis
Störningar av den normala
språkutvecklingen som uppträder i de
tidigaste utvecklingsstadierna. Tillstånden
kan inte direkt tillskrivas neurologisk
sjukdom, abnormitet i talapparaten,
sensoriska störningar, psykisk
utvecklingsstörning eller miljöfaktorer.
Dessa tal- och språkstörningar är ofta följda
av andra störningar såsom
inlärningssvårigheter, kontaktsvårigheter,
känslomässiga svårigheter och
beteendestörningar.
F80.0
Specifik störning av
artikulationsförmågan
En specifik utvecklingsstörning där barnet
använder språkljud som är under den
förväntade nivån med tanke på dess mentala
ålder. Språkutvecklingen är i övrigt normal.
Dyslali
Funktionell störning av
artikulationsförmågan
Lallande
Utvecklingsstörning av:
• artikulationsförmåga
• fonologi
F80.1A
Grammatisk språkstörning
F80.1B
Fonologisk och grammatisk
språkstörning
F80.1C
Semantisk språkstörning
F80.2
Impressiv språkstörning
En specifik utvecklingsstörning där barnets
språkförståelse är under den nivå man kan
förvänta sig med tanke på mental ålder.
Ledsagas nästan alltid av expressiv dysfasi
och ofta av abnormiteter i ord- och ljuduttal.
Medfödd avsaknad av hörselperception
Orddövhet
Störd utveckling med Wernickes afasi
Utvecklingsdysfasi eller afasi, receptiv
typ
Utesluter:
Störning av artikulationsförmågan
(orsakad av):
• afasi UNS (R47.0)
• apraxi (R48.2)
• hörselförlust (H90-H91)
• med språklig utvecklingsstörning:
• expressiv (F80.1)
• impressiv (F80.2)
• psykisk utvecklingsstörning
(F70-F79)
F80.0A
Fonologisk språkstörning
F80.0B
Utvecklingsförsening av oralmotorik
F80.0C
Dyslali och liknande
artikulationsavvikelse
F80.1
Expressiv språkstörning
Utesluter:
Autism (F84.0-F84.1)
Dysfasi och afasi:
• UNS (R47.0)
• expressiv typ (F80.1)
Elektiv mutism (F94.0)
Förvärvad afasi med epilepsi [LandauKleffner] (F80.3)
Psykisk utvecklingsstörning (F70-F79)
Språkförsening orsakad av dövhet (H90H91)
En specifik utvecklingsstörning där barnets
förmåga att uttrycka sig med talspråk är
under den nivå man kan förvänta sig med
tanke på den mentala åldern men där
språkförståelsen är inom normala gränser.
Tillståndet kan eventuellt ledsagas av
artikulationsstörningar.
Utvecklingsdysfasi eller afasi, expressiv
typ
Utesluter:
Dysfasi och afasi UNS (R47.0)
Elektiv mutism (F94.0)
Förvärvad afasi med epilepsi [LandauKleffner] (F80.3)
Genomgripande utvecklingsstörningar
(F84.-)
Psykisk utvecklingsstörning (F70-F79)
Utvecklingsdysfasi eller afasi, impressiv
typ (F80.2)
214
F80.2A
Impressiv språkförsening (ord- och
satsförståelse)
F80.2B
Generell språkförsening (impressiv och
expressiv)
F80.2C
Pragmatisk språkförsening
F80.3
F81
Förvärvad afasi med epilepsi
[Landau-Kleffner]
Ett tillstånd där barnet som tidigare haft
normal språkutveckling drabbas av både
impressiv och expressiv språkstörning trots
bevarad intelligensnivå. Då tillståndet
debuterar åtföljs det av paroxysmala EEGabnormiteter och de flesta patienterna har
även epileptiska anfall. Debutålder är
vanligtvis mellan tre och sju år och
språkförlusten sker över dagar och veckor.
Den tidsmässiga relationen mellan debut av
epileptiska anfall och språkförlusten
varierar något; således kan den ena
komponenten föregå den andra med mellan
några få månader och två år. En
inflammatorisk encefalitisk process har
föreslagits som möjlig orsak. I två
tredjedelar av fallen blir slutresultatet mer
eller mindre uttalade impressiva
språkdefekter.
Perturbationes specificae
progressionis facultatum
scholasticarum discendi
Störningar där det normala mönstret för
inhämtning av skolfärdigheter är störd från
tidigt utvecklingsstadium. Störningarna
uppkommer inte enbart till följd av brister i
utbildningssystem, beror ej heller enbart på
psykisk utvecklingsstörning och orsakas inte
av någon förvärvad hjärnskada eller
hjärnsjukdom.
F81.0
Andra specificerade störningar av taloch språkutvecklingen
Läspning
F80.8A
Prosodisk talstörning
F80.8B
Läspning
F80.8C
R-fel
F80.8D
Generell interdentalism
F80.8W
Andra specificerade störningar av taloch språkutvecklingen
F80.9
Störning av tal- och
språkutvecklingen, ospecificerad
Specifik lässvårighet
Störningens främsta kännetecken är en
specifik och klart försämrad utveckling av
läsförmågan som inte bara beror på mental
ålder, synproblem eller inadekvat skolgång.
Läsförståelse, ordigenkännelse,
högläsningsförmåga och problemlösning
som kräver intakt läsförmåga kan alla
påverkas menligt. Stavningssvårigheter är
ofta förbundna med specifika lässvårigheter
och varar ofta upp i adolescensen även efter
att läsförmågan förbättrats. Specifika
lässvårigheter föregås ofta av störningar i
tal- och språkutvecklingen. Associerade
emotionella störningar och
beteendestörningar uppträder ofta under
skolåldern.
Baklängesläsning
Specifik läsförsening
Utvecklingsdyslexi
Utesluter:
Afasi (orsakad av):
• autism (F84.0-F84.1)
• desintegrativa störningar i barndomen
(F84.2-F84.3)
• UNS (R47.0)
F80.8
Specifika
utvecklingsstörningar av
inlärningsfärdigheter
Utesluter:
Alexi UNS (R48.0)
Dyslexi UNS (R48.0)
Lässvårigheter sekundära till emotionella
störningar (F93.-)
F81.1
Specifik stavningssvårighet
Störningens främsta kännetecken är en
specifik och klar försämring av utvecklingen
av stavningsförmågan utan samtidig
försämring av läsfärdigheten. Tillståndet
beror inte på låg mental ålder, synproblem
eller bristfällig skolgång. Förmågan att
stava och skriva korrekt är påverkad.
Språkstörning UNS
Utesluter:
Agrafi UNS (R48.8)
Stavningssvårigheter:
• förenade med lässvårigheter (F81.0)
• orsakade av bristfällig undervisning
(Z55.8)
215
F81.2
F82
Specifik räknesvårighet
Avser en specifik försämring av matematiska
färdigheter som inte kan skyllas på psykisk
utvecklingsstörning eller bristfällig
skolgång. Räknesvårigheterna innefattar
bristande förmåga att behärska basala
räknefärdigheter såsom addition,
subtraktion, multiplikation och division
snarare än de mer abstrakta matematiska
färdigheter som krävs i algebra,
trigonometri, geometri och komplexa
beräkningar.
Utvecklingsbetingad:
• akalkuli
• aritmetisk störning
• Gerstmanns syndrom
Perturbatio progressionis
specifica functionis motoriae
En störning som karakteriseras av en
allvarlig rubbning i utvecklingen av
motorisk koordination och som inte låter sig
förklaras enbart med psykisk
utvecklingsstörning eller en specifik
kongenital eller förvärvad neurologisk
sjukdom. I de flesta fall visar emellertid en
noggrann klinisk undersökning uttalade
störningar i den neurologiska mognaden
såsom koreiforma rörelser av obelastade
extremiteter, synkinesier, andra motoriska
störningar eller tecken på dyskoordination
av fin- eller grovmotorik.
Clumsy child syndrome
Utvecklingsbetingad:
• dyspraxi
• störning av koordination
Utesluter:
Akalkuli UNS (R48.8)
Räknesvårigheter:
• förenade med läs- eller
stavningssvårigheter (F81.3)
• orsakade av bristfällig undervisning
(Z55.8)
F81.3
Utesluter:
Abnormiteter i gång och rörlighet (R26.)
Avsaknad av koordination (R27.-)
Sekundärt till psykisk
utvecklingsstörning (F70-F79)
Blandad inlärningsstörning
En mindre väldefinierad restgrupp av
tillstånd där både räkne-, läs- och
stavningsfärdigheter är klart påverkade men
där störningen inte enbart kan förklaras av
psykisk utvecklingsstörning eller bristfällig
skolgång. Denna kategori ska användas vid
tillstånd som uppfyller kriterier från F81.2
tillsammans med kriterier från F81.0 eller
F81.1.
Utesluter:
Specifika:
• lässvårigheter (F81.0)
• räknesvårigheter (F81.2)
• stavningssvårigheter (F81.1)
F81.8
Andra specificerade
inlärningsstörningar
F81.9
Inlärningsstörning, ospecificerad
Inlärningssvårigheter UNS
Svårigheter att förvärva kunskaper UNS
216
Specifik motorisk
utvecklingsstörning
F83
Blandade specifika
utvecklingsstörningar
Perturbationes mixtae
progressionis mentalis
Detta är en restgrupp av störningar där det
finns en blandning av specifika rubbningar i
utvecklingen av talet, språket, inlärningen
och de motoriska funktionerna, utan att
någon störning dominerar eller utgör
huvuddiagnos. Denna blandkategori bör
endast användas där det finns en betydande
överlappning mellan de specifika
störningarna. Tillståndet ledsagas ofta, men
inte alltid, av en viss grad av försämrad
kognitiv förmåga. Kategorin bör alltså
brukas då dysfunktion som motsvarar minst
två av kategorierna F80.-, F81.- och F82
föreligger.
F84
Genomgripande
utvecklingsstörningar
Perturbationes pervasivae
progressionis mentalis
F84.2
Ett tillstånd, hittills bara funnet hos flickor,
där en till synes normal tidig utveckling följs
av partiell eller total förlust av tal,
gångsvårigheter, förmåga att bruka
händerna och minskad kranietillväxt.
Debutålder är vanligtvis mellan 7 och 24
månaders ålder. Karakteristiskt är förlust av
ändamålsenliga handrörelser, handvridande
stereotypier och hyperventilation. Social
utveckling upphör men sociala intressen
vidmakthålls. Bålataxi och apraxi börjar
utvecklas vid fyra års ålder och följs ofta av
koreatiska rörelser. Tillståndet slutar ofta
med svår psykisk utvecklingsstörning.
En grupp störningar som karakteriseras av
kvalitativa rubbningar i socialt samspel och
kommunikationsmönster samt av en
begränsad, stereotyp och repetitiv repertoar
av intressen och aktiviteter. Störningarna är
genomgripande och präglar individens sätt
att fungera i alla situationer.
Tilläggskod kan användas när störningen är
förenad med kroppslig sjukdom eller
psykisk utvecklingsstörning.
F84.0
Autism i barndomen
F84.3
En genomgripande utvecklingsstörning som
manifesterar sig före tre års ålder och
karakteriseras av försämrad utveckling av
socialt samspel, kommunikationsförmåga
och av ett begränsat, stereotypt och
repetitivt beteende. Härtill kommer en rad
mindre specifika fenomen som fobier, sömnoch ätstörningar, raserianfall och
självdestruktivt beteende.
Autistisk störning
Infantil:
• autism
• psykos
Kanners syndrom
Utesluter:
Autistisk psykopati (F84.5)
F84.1
Atypisk autism
En genomgripande utvecklingsrubbning som
skiljer sig från autism i barndomen genom
senare debut eller genom att inte uppfylla
kriterierna på alla de tre områden som
karakteriserar autism i barndomen. Denna
subkategori används då utvecklingen först
efter tre års ålder blir avvikande och
försenad och när det saknas påvisbara
störningar inom ett eller två av de
psykopatologiska områden som
kännetecknar autism i barndomen (störning
i samspel, kommunikationssvårigheter samt
begränsat, stereotypt och repetitivt
beteende), trots samtidig närvaro av
karakteristiska störningar inom resterande
områden. Atypisk autism ses oftast vid grav
psykisk utvecklingsstörning eller vid svår
impressiv språkstörning.
Atypisk barndomspsykos
Psykisk utvecklingsstörning med
autistiska drag
Tilläggskod kan användas för att ange
psykisk utvecklingsstörning
217
Retts syndrom
Annan desintegrativ störning i
barndomen
En form av genomgripande
utvecklingsstörning som inträder efter en
period med helt normal utveckling och som
visar sig som en tydlig förlust av tidigare
förvärvade färdigheter inom ett flertal
områden inom loppet av några få månader.
Tillståndet ledsagas av förlust av intresse
för omgivningen, stereotypa repetitiva
rörelser och en autismliknande störning av
socialt samspel och kommunikation. I några
fall kan tillståndet sättas i förbindelse med
encefalopati, men diagnosen ska ställas på
beteendemanifestationer.
Dementia infantilis
Desintegrativ psykos
Hellers syndrom
Symbiotisk psykos
Tilläggskod kan användas för att identifiera
varje associerat neurologiskt tillstånd
Utesluter:
Retts syndrom (F84.2)
F84.4
Överaktivitetssyndrom förenat med
psykisk utvecklingsstörning och
stereotypa rörelser
Mindre väldefinierad störning med osäker
nosologisk validitet. Denna kategori är
förbehållen barn med svår psykisk
utvecklingsstörning (IQ mindre än 35) med
hyperaktivitetsproblem,
uppmärksamhetsstörning och stereotypt
beteende. Centralstimulerande farmaka har
vanligtvis ingen effekt (till skillnad från
liknande tillstånd med normal IQ) och kan
framkalla dysforiska reaktioner (ibland med
psykomotorisk hämning). I adolescensen
ersätts hyperaktiviteten med hypoaktivitet
(ett mönster som inte ses hos hyperkinetiska
barn med normal intelligens). Syndromet är
ofta förenat med olika
utvecklingsstörningar, specifika eller mer
globala. I vilken grad beteendestörningen
betingas av låg IQ eller organisk hjärnskada
är inte känt.
F84.5
Aspergers syndrom
F84.8
Andra specificerade genomgripande
utvecklingsstörningar
F84.9
Genomgripande utvecklingsstörning,
ospecificerad
F88
Andra specificerade störningar
av psykisk utveckling
BETEENDESTÖRNINGAR OCH
EMOTIONELLA STÖRNINGAR MED
DEBUT VANLIGEN UNDER BARNDOM
OCH UNGDOMSTID (F90-F98)
Perturbationes morum et emotionum
plerumque in infantia et adolescentia
incipientes
F90
Perturbationes hyperkineticae
En grupp störningar som karakteriseras av
tidig debut (vanligtvis under de första fem
levnadsåren), bristande uthållighet i
aktiviteter som kräver kognitiva funktioner
och en tendens att växla mellan olika
aktiviteter utan att slutföra någon av dem,
tillsammans med desorganiserad, oplanerad
och överdriven aktivitet. Tillståndet kan
vara förenat med flera andra abnormiteter.
Hyperaktiva barn är ofta vårdslösa och
impulsiva, de råkar lätt ut för olyckor och
hamnar ofta i disciplinproblem på grund av
tanklöshet då det gäller att följa normer och
regler snarare än på grund av trots. I sitt
förhållande till vuxna är de ofta socialt
ohämmade, med brist på normal försiktighet
och blyghet. De är inte populära bland
andra barn och blir ofta isolerade.
Kognitiva störningar ses ofta och specifika
störningar i den motoriska och språkliga
utvecklingen är vanliga. Sekundära
komplikationer omfattar asocialt beteende
och dålig självkänsla.
Autistisk psykopati
Schizoid störning i barndomen
Utesluter:
Förstämningssyndrom [affektiva
syndrom] (F30-F39)
Genomgripande utvecklingsstörningar
(F84.-)
Schizofreni (F20.-)
Ångestsyndrom (F41.-)
Aliae perturbationes
progressionis mentalis
Utvecklingsagnosi
F89
Ospecificerad störning av
psykisk utveckling
F90.0
Perturbationes non specificatae
progressionis mentalis
Hyperaktivitetsstörningar
Aktivitets- och
uppmärksamhetsstörning
Attention Deficit and Hyperactivity
Disorder [ADHD]
Dysfunction of Attention, Motor Control
and Perception [DAMP]
Uppmärksamhetsstörning med
hyperaktivitet
Utvecklingsstörning UNS
Utesluter:
Hyperaktiv beteendestörning (F90.1)
F90.0A
218
Dysfunction of Attention, Motor Control
and Perception (DAMP)
F91
F90.0B
Attention Deficit and Hyperactivity
Disorder (ADHD)
F90.0C
Attention Deficit Disorder (ADD)
F90.0X
Aktivitets- och uppmärksamhetsstörning
UNS
F90.1
Hyperaktiv beteendestörning
F90.8
Andra specificerade
hyperaktivitetsstörningar
F90.9
Hyperaktivitetsstörning, ospecificerad
Beteendestörningar av
utagerande slag
Perturbationes asociales sive
aggressivae
Beteendestörningar som karakteriseras av
ett repetitivt och kvarstående mönster av
asocialt, aggressivt eller trotsigt beteende.
Beteendet utgör ett flagrant brott mot
samhällets föreställningar om vad som är
normalt för åldern och är således både
allvarligare och långvarigare (minst sex
månaders varaktighet) än det trotsiga och
ibland rebelliska beteende som kan
förekomma normalt hos barn och ungdom.
Beteendestörningen kan vara ett symtom på
andra psykiska tillstånd och då ges den
underliggande diagnosen prioritet.
Hyperaktiv störning förenad med
beteenderubbning
Hyperaktiv reaktion under barndom och
ungdomstid
Hyperaktivitetssyndrom UNS
Minimal Brain Dysfunction [MBD]
Diagnosen bygger på beteenden som
överdriven stridslystenhet, tyranniserande,
grymhet mot människor och djur,
förstörande av andras egendom,
pyromandåd, stöld, ihärdig lögnaktighet,
skolk, rymning från hemmet, raserianfall
och olydnad. Något av dessa beteenden, om
uttalat, räcker för diagnos men isolerade
asociala handlingar gör det inte.
Utesluter:
Förstämningssyndrom [affektiva
syndrom] (F30-F39)
Genomgripande utvecklingsstörning
(F84.-)
När förenade med:
• emotionella störningar (F92.-)
• hyperaktivitetsstörningar (F90.1)
Schizofreni (F20.-)
F91.0
Beteendestörning av utagerande slag,
begränsad till familjesammanhang
Beteendestörning med asocialt och
aggressivt beteende (inte enbart
oppositionellt, trotsigt och störande
beteende) där det avvikande beteendet helt
eller övervägande är begränsat till hemmet
och till samspelet med kärnfamiljen eller
hushållets medlemmar. Störningen skall
uppfylla kriterierna under F91.-. Andra
störningar i förhållandet mellan förälder
och barn, om än allvarliga, är inte
tillräckliga för denna diagnos.
219
F91.1
F92
Beteendestörning med aggressivitet
och bristande social anpassning
Tillståndet karakteriseras av långvarigt
asocialt och aggressivt beteende (uppfyller
kriterierna för F91.- och omfattar inte bara
oppositionellt, trotsigt eller störande
beteende) i kombination med betydande och
långvariga störningar i individens relationer
med andra barn.
Asocial aggressiv störning
Beteendestörning, ensam aggressiv form
F91.2
F91.3
Perturbationes mixtae morum et
emotionum
En grupp störningar som karakteriseras av
en kombination av aggressivitet, asocialt
eller trotspräglat beteende med uppenbara
och uttalade symtom på depression, ångest
eller andra emotionella störningar.
Kriterierna för beteendestörningar av
utagerande slag i barndomen (F91.-)
tillsammans med emotionell störning i
barndomen (F93.-) eller för en vuxen typ av
neurosdiagnos (F40-F48) eller för ett
förstämningssyndrom (F30- F39) måste
vara uppfyllda.
Beteendestörning med aggressivitet
men med normal social anpassning
En störning som innefattar långvarigt
asocialt eller aggressivt beteende (uppfyller
kriterierna för F91.- och omfattar inte bara
oppositionellt, trotsigt eller störande
beteende) som förekommer hos individer
som i allmänhet är välintegrerade i sin
åldersgrupp.
Aggressiv beteendestörning, gruppform
Gruppförseelse
Gängbrottslighet
Skolskolk
Stölder i sällskap med andra
F92.0
F92.8
Andra specificerade
beteendestörningar av utagerande
slag
F91.9
Beteendestörning av utagerande slag,
ospecificerad
220
Andra specificerade blandade
störningar i beteende och känsloliv
Till denna kategori hör beteendestörningar
av utagerande slag (F91.-) i kombination
med långvariga och uttalade emotionella
symtom såsom ångest, fruktan, obsessioner
eller kompulsioner, depersonalisation eller
derealisation, fobier eller hypokondrier.
Beteendestörning under F91.- förenad
med:
• emotionell störning under F93.• neurotisk störning under F40-F48
F92.9
F91.8
Depressiv beteendestörning
Denna kategori kräver en kombination av
beteendestörningar (F91.-) med varaktig
och markant nedstämdhet (F32.-), som
kommer till uttryck i form av förtvivlan,
intresseförlust och oförmåga att glädja sig
åt sedvanliga aktiviteter, självanklagelser
och hopplöshetskänslor. Störning av aptit
och sömn kan också ses.
Beteendestörning under F91.- förenad
med depressiv störning under F32.-
Trotssyndrom
Beteendestörningar som vanligtvis
uppträder hos mindre barn. Karakteriseras
av olydnad, trots och fientlighet men
omfattar inte kriminella handlingar eller
mer extrema former av aggressivitet eller
asocialt beteende. För diagnosen krävs att
de överordnade kriterierna för F91.- är
uppfyllda; inte ens ett uttalat okynnes- och
olydnadsbeteende är i och för sig tillräckligt
för diagnos. Försiktighet bör iakttas vid
bruk av denna kategori, särskilt när det
gäller större barn, då den kliniskt betydande
beteendestörningen vanligtvis ledsagas av
asocialt eller aggressivt beteende som går
utöver olydnad, trots och fientlighet.
Blandade störningar av
beteende och känsloliv
Blandad störning i beteende och
känsloliv, ospecificerad
F93
Emotionella störningar med
debut särskilt under
barndomen
F93.2
Karakteriseras av överdriven skygghet inför
obekanta människor och av ångest i nya,
främmande eller socialt hotfulla situationer.
Denna kategori är aktuell endast då
ängsligheten uppstår i tidiga barndomsår
och karakteriseras av både osedvanlig
svårighetsgrad och nedsatt social
funktionsförmåga.
Perturbationes praecipue in
infantia incipientes
Dessa är huvudsakligen abnormt förstärkta
normala utvecklingsdrag snarare än
fenomen som är kvalitativt abnorma i sig
själva. Förekomst i förbindelse med normal
utveckling är det avgörande draget i
differentialdiagnostik mellan emotionella
störningar i barndomen (F93.-) och fobiska
syndrom (F40-F48).
F93.3
Separationsångest i barndomen
Abnorm separationsångest diagnostiseras
när fruktan för att åtskiljas utgör kärnan i
ångesten och när ångesten uppstått under de
första levnadsåren. Den kan skiljas från
normal separationsångest genom dess
svårighetsgrad, som statistiskt sett är
ovanlig, genom att den är långvarig och
genom att den medför nedsatt social
funktionsnivå.
Utesluter:
Fobiska ångesttillstånd i barndomen
(F93.1)
Förstämningssyndrom [affektiva
syndrom] (F30-F39)
Neurotiska störningar (F40-F48)
Social ångest i barndomen (F93.2)
F93.1
Syskonrivalitet
En viss grad av känslomässig störning ses
hos de flesta barn då nästa kommer i
syskonskaran. Syskonrivalitet ska bara
diagnostiseras då störningen är osedvanligt
våldsam, varaktig och förbunden med
nedsatt social funktionsförmåga.
Syskonsvartsjuka
Utesluter:
När tillståndet är förenat med
beteendestörning (F92.-)
F93.0
Social ångest i barndomen
F93.8
Andra specificerade emotionella
störningar i barndomen
Identitetsstörning
Överdriven ängslighet
F93.9
Emotionell störning i barndomen,
ospecificerad
F94
Störningar av social funktion
med debut särskilt under
barndom och ungdomstid
Perturbationes functionis socialis
praecipue in infantia et
adolescentia incipientes
Fobisk ångest i barndomen
Ångestfenomen i barndomen som är typiska
för olika utvecklingsfaser och som kan ses
hos de flesta barn men som här uppträder
med osedvanlig svårighetsgrad. Andra
ångesttillstånd som uppstår i barndomen
och som inte är en del av den normala
psykosociala utvecklingen, exempelvis
agorafobi, bör kodas under den relevanta
kategorin i avsnittet F40-F48.
Utesluter:
Generaliserat ångestsyndrom (F41.1)
221
Detta är en något heterogen grupp av
störningar som kännetecknas av avvikelser i
den sociala funktionsnivån. De visar sig i
barndomen och adolescensen men till
skillnad från de mer genomgripande
utvecklingsstörningarna karakteriseras de
inte av någon personlighetsbunden
sviktande eller bristande social
funktionsförmåga som genomsyrar alla
funktionsområden. Snarast synes allvarliga
brister i barnets miljö eller svåra
umbäranden spela en avgörande etiologisk
roll.
F94.0
F94.2
Elektiv mutism
Karakteriseras av en uttalad, emotionellt
bestämd selektivitet i talet. I vissa
situationer demonstrerar barnet normal
språklig kompetens, i andra, relativt
väldefinierade situationer är barnet stumt.
Störningen ledsagas vanligen av särskilda
personlighetsdrag, med social ångest,
tillbakadragenhet, känslighet eller motstånd
i sociala relationer.
Selektiv mutism
Utesluter:
Genomgripande utvecklingsstörning
(F84.-)
Schizofreni (F20.-)
Specifika störningar i tal- och
språkutvecklingen (F80.-)
Övergående mutism som ett led i
separationsångest under tidig barndom
(F93.0)
F94.1
Distanslöshet hos barn
Avvikande sociala funktionsmönster som
uppstår inom de första fem levnadsåren och
som tenderar att kvarstå oavsett
miljöförändringar. Visar sig som diffust
oselektivt kontaktbeteende,
uppmärksamhetssökande beteende, okritisk
vänskaplighet, onyanserat förhållande till
jämnåriga samt eventuellt också emotionella
och beteendemässiga störningar.
Affektionslös psykopati
Institutionssyndrom
Utesluter:
Aspergers syndrom (F84.5)
Hospitaliseringsreaktion hos barn
(F43.2)
Hyperaktivitetsstörningar (F90.-)
Reaktiv störning i känslomässig bindning
under barndomen (F94.1)
Reaktiv störning i känslomässig
bindning under barndomen
Störningen debuterar under de första fem
levnadsåren och karakteriseras av varaktiga
avvikelser i barnets kontaktmönster.
Avvikelserna är förknippade med
emotionella störningar men kan påverkas i
gynnsam riktning av förbättringar i
uppväxtmiljön. Karakteristiska drag är
fruktan och ökad vaksamhet, dålig social
funktion tillsammans med jämnåriga,
aggressivitet riktad mot sig själv eller andra,
nedstämdhet och i vissa fall tillväxthämning.
Störningen uppträder ofta som en direkt
följd av svår omsorgssvikt, vanvård eller
misshandel från föräldrarnas sida.
F94.8
Andra specificerade störningar av
social funktion hos barn
F94.9
Störning av social funktion hos barn,
ospecificerad
F95
Tics
Tics
Syndrom där det dominerande draget är en
eller annan form av tics. Tics är ofrivilliga,
snabba, återkommande, icke-rytmiska
muskelrörelser (oftast omfattande bestämda
muskelgrupper) eller plötsliga ljud utan
uppenbart syfte. Tics upplevs som
oemotståndliga men kan vanligtvis
undertryckas för kortare eller längre
stunder. De förvärras vid belastning och
försvinner under sömn. Vanliga motoriska
tics innefattar blinkningar, huvudkast,
skulderryckningar och ansiktsgrimaser.
Vanliga vokala tics innefattar harklingar,
hostningar, snörvlingar och väsanden.
Vanliga komplexa tics (ekopraxi) kan
innefatta hoppande, springande eller slag
mot den egna kroppen. Vanliga komplexa
vokala tics innebär upprepningar av
särskilda ord, ibland sådana som är socialt
oacceptabla och oftast obscena (koprolali).
Tilläggskod kan användas för att ange
associerad ”failure to thrive” eller
tillväxthämning
Utesluter:
Aspergers syndrom (F84.5)
Distanslöshet hos barn (F94.2)
Fobiska ångesttillstånd i barndomen
(F93.1)
Misshandelssyndrom (T74.-)
Normal variation i mönstret av selektiv
tillgivenhet
Sexuell eller fysisk misshandel i
barndomen som resulterar i psykosociala
problem (Z61.4-Z61.6)
F95.0
Övergående tics
Uppfyller de allmänna kriterierna för tics
men är övergående med en varaktighet som
understiger tolv månader. De visar sig oftast
som blinkningar, ansiktsgrimaser eller
huvudkastningar.
222
F95.1
F98.0
Kroniska motoriska eller vokala tics
Uppfyller de allmänna kriterierna för tics
med endera motoriska eller vokala tics (men
inte bägge) som kan förekomma ensamma
men som oftast är multipla och varar i mer
än ett år.
F95.2
En störning som karakteriseras av ofrivillig
urinavgång, i vaket tillstånd under dagen
eller i sömnen under natten, och som är
abnorm i förhållande till mental ålder, och
inte kan förklaras med bristande
blåskontroll på grund av neurologisk
sjukdom, epileptiska anfall eller anatomisk
anomali i urinvägarna. Enuresen kan ha
varat från födseln eller uppstått efter en
period med full blåskontroll. Enuresen kan
eventuellt vara ledsagad av mer omfattande
emotionella eller beteendemässiga
störningar.
Enures (primär, sekundär) av icke
organisk orsak
Funktionell enures
Psykogen enures
Urininkontinens av icke organisk orsak
Utesluter:
Enures UNS (R32)
Kombinerade vokala och multipla
motoriska tics [de la Tourette]
Ett ticsyndrom där det är, eller har varit,
multipla motoriska tics och en eller flera
vokala tics även om dessa inte har uppträtt
samtidigt. Tillståndet förvärras oftast under
adolescensen och brukar kvarstå upp i
vuxen ålder. De vokala ticsen är ofta
multipla med explosiva, repetitiva ljud som
harklingar, grymtanden eller obscena ord
eller satser. Ibland ses också komplexa
motoriska tics (ekopraxi) som kan vara av
obscen natur (kopropraxi).
F95.8
Andra specificerade tics
F95.9
Tics, ospecificerade
F98
Tics UNS
Andra beteendestörningar och
emotionella störningar med
debut vanligen under barndom
och ungdomstid
Icke organisk enures
F98.0A
Enures, primär, icke organisk
F98.0B
Enures, sekundär, icke organisk
F98.0C
Enures, psykogen
F98.0W
Annan specificerad icke organisk enures
F98.1
Icke organisk enkopres
Återkommande, frivillig eller ofrivillig
tarmtömning, vanligen med normal eller
någorlunda normal konsistens, på platser
som är olämpliga med hänsyn till individens
sociala och kulturella förhållanden.
Tillståndet kan vara ett abnormt
kvardröjande av den normala infantila
inkontinensen eller kan ha utvecklat sig efter
en period med full tarmkontroll. Det kan
också yttra sig som avsiktlig tarmtömning på
opassande platser trots normal tarmkontroll.
Tillståndet kan uppträda som ett isolerat
symtom eller utgöra en del av en mer
omfattande emotionell (F93.-) eller
beteendemässig störning (F91.-).
Fecesinkontinens av icke organisk orsak
Funktionell enkopres
Psykogen enkopres
Aliae perturbationes morum et
emotionum praecipue in infantia
et adolescentia incipientes
En grupp heterogena störningar som
karakteriseras av debut i barndomen men
som annars skiljer sig åt i många avseenden.
Några av tillstånden representerar
väldefinierade syndrom men andra är inte
mer än symtomkomplex som inkluderas på
grund av deras frekvens och koppling till
psykosociala problem samt på grund av
svårigheten att inkorporera dem under
andra syndrom.
Utesluter:
Frivilliga andningsuppehåll (R06.8)
Kleine-Levins syndrom (G47.8)
Sömnstörning orsakad av emotionella
faktorer (F51.-)
Tvångssyndrom (F42.-)
Tilläggskod kan användas för att identifiera
orsak till samtidig obstipation.
Utesluter:
Enkopres UNS (R15)
223
F98.1A
Enkopres, funktionell, icke organisk
F98.1B
Enkopres, psykogen
F98.1W
F98.2
Annan specificerad icke organisk
enkopres
F98.4
Viljemässiga, repetitiva, stereotypa, icke
funktionella (ofta rytmiska) rörelser som inte
ingår i någon känd psykiatrisk eller
neurologisk sjukdomsbild. När sådana
rörelser uppträder som symtom vid andra
störningar bör endast huvuddiagnos kodas.
Rörelserna kan vara icke självskadande,
såsom ryckningar, huvudkastningar,
hårplockande, hårsnoende, dragande i
fingrar och leder. Självmutilerande
stereotypt beteende innefattar
huvudbankningar, ansiktsslag, ögonpetande,
bitande i händer, läppar eller på andra
delar av kroppen. Alla stereotypa rörelser är
vanligast tillsammans med psykisk
utvecklingsstörning (om så är fallet ska
båda tillstånden noteras). Om ögonpetandet
förekommer hos ett barn med nedsatt syn
ska bägge tillstånden kodas - ögonpetandet
under denna kategori och syndefekten under
den relevanta somatiska koden.
Matvägran hos spädbarn och barn
Födointagsstörning med varierande
manifestationer som uppträder i
spädbarnsåldern och tidiga barnaår. Den
yttrar sig som matvägran och extrem
kräsenhet och kan inte förklaras med
födobrist, dålig kompetens hos
vårdnadshavaren eller organisk sjukdom.
Störningen kan eventuellt vara ledsagad av
idisslande (återkommande regurgitationer
utan åtföljande kräkningar eller
gastrointestinal sjukdom).
Ruminationstillstånd hos spädbarn
Utesluter:
Anorexia nervosa och andra ätstörningar
(F50.-)
Födointagsproblem hos nyfödd (P92.-)
Picasyndrom hos spädbarn och barn
(F98.3)
Svårigheter med och misskötsel av
födointag (R63.3)
F98.3
Utesluter:
Abnorma ofrivilliga rörelser (R25.-)
Nagelbitning (F98.8)
Näspetning (F98.8)
Rörelsestörningar av organisk orsak
(G20-G25)
Stereotypier som är del av bredare
psykiatriskt tillstånd (F00-F95)
Tics (F95.-)
Trikotillomani (F63.3)
Tumsugning (F98.8)
Picasyndrom hos spädbarn och barn
Ständigt ätande av icke nutritiva substanser
såsom jord, sand, pappersbitar eller
liknande. Störningen kan uppträda som ett
symtom vid mer omfattande psykiska
sjukdomar som infantil autism eller som ett
relativt isolerat psykopatologiskt beteende.
Endast i det senare fallet kodas störningen
här. Fenomenet är vanligt vid psykisk
utvecklingsstörning som då bör användas
som huvuddiagnos (F70-F79).
Rörelsestereotypier
F98.5
Stamning
Karakteriseras av återkommande
repetitioner eller förlängningar av ljud,
stavelser eller ord, eller av återkommande
uppehåll eller pauser som avbryter den
rytmiska talströmmen. Problemet bör
klassificeras som störning bara när
svårighetsgraden påverkar talfärdigheten.
Utesluter:
Skenande tal (F98.6)
Tics (F95.-)
224
F98.5A
Stamning
F98.5W
Annan specificerad störning av typ
stamning
F98.5X
Ospecificerad störning av typ stamning
F98.6
OSPECIFICERAD PSYKISK STÖRNING
(F99)
Skenande tal
Forsande tal som är svårbegripligt, dock
utan omtagningar eller pauser. Talet är
ojämnt och arytmiskt med snabba, ryckiga
stötar som oftast stör fraseringen.
Perturbatio mentis non specificata
F99
Utesluter:
Tics (F95.-)
Stamning (F98.5)
Psykisk sjukdom UNS
Utesluter:
Organisk psykisk störning UNS (F06.9)
F98.6A
Skenande tal, cluttering
F98.6W
Annan specificerad störning av typ
skenande tal
F98.8
Andra specificerade
beteendestörningar och emotionella
störningar med debut vanligen under
barndom och ungdomstid
Bristande uppmärksamhet utan
hyperaktivitet
Nagelbitning
Näspetning
Tumsugning
Överdriven masturbation
F98.9
Psykisk störning ej
specificerad på annat sätt
Beteendestörning och emotionell
störning med debut vanligen under
barndom och ungdomstid,
ospecificerad
225
Kapitel 6
Sjukdomar i nervsystemet
(G00-G99)
Morbi systematis nervosi
Utesluter:
Endokrina sjukdomar, nutritionsrubbningar och ämnesomsättningssjukdomar (E00-E90)
Komplikationer vid graviditet, förlossning och under barnsängstid (O00-O99)
Medfödda missbildningar, deformiteter och kromosomavvikelser (Q00-Q99)
Skador, förgiftningar och vissa andra följder av yttre orsaker (S00-T98)
Symtom, sjukdomstecken och onormala kliniska fynd och laboratoriefynd som ej
klassificeras på annan plats (R00-R99)
Tumörer (C00-D48)
Vissa infektions- och parasitsjukdomar (A00-B99)
Vissa perinatala tillstånd (P00-P96)
Detta kapitel innehåller följande avsnitt:
G00-G09 Inflammatoriska sjukdomar i centrala nervsystemet
G10-G14 Systemiska atrofier som primärt engagerar centrala nervsystemet
G20-G26 Basalgangliesjukdomar och rörelserubbningar
G30-G32 Andra degenerativa sjukdomar i nervsystemet
G35-G37 Myelinförstörande sjukdomar i centrala nervsystemet
G40-G47 Episodiska och paroxysmala sjukdomar
G50-G59 Sjukdomar i nerver, nervrötter och nervplexus
G60-G64 Polyneuropatier och andra sjukdomar i perifera nervsystemet
G70-G73 Neuromuskulära transmissionsrubbningar och sjukdomar i muskler
G80-G83 Cerebral pares och andra förlamningssyndrom
G90-G99 Andra sjukdomar i nervsystemet
Detta kapitel innehåller följande asteriskkoder:
G01* Meningit vid bakteriesjukdomar som klassificeras på annan plats
G02* Meningit vid andra infektions- och parasitsjukdomar som klassificeras på annan
plats
G05* Encefalit, myelit och encefalomyelit vid sjukdomar som klassificeras på annan plats
G07* Abscess och granulom i skallen och ryggradskanalen vid sjukdomar som
klassificeras på annan plats
G13* Systemiska atrofier som primärt engagerar centrala nervsystemet vid sjukdomar
som klassificeras på annan plats
G22* Parkinsonism vid sjukdomar som klassificeras på annan plats
226
G26* Basalganglietillstånd och rörelserubbningar vid sjukdomar som klassificeras på
annan plats
G32* Andra degenerativa tillstånd i nervsystemet vid sjukdomar som klassificeras på
annan plats
G46* Vaskulära syndrom i hjärnan vid cerebrovaskulära sjukdomar
G53* Förändringar i kranialnerver vid sjukdomar som klassificeras på annan plats
G55* Kompression av nervrötter och nervplexus vid sjukdomar som klassificeras på
annan plats
G59* Mononeuropati vid sjukdomar som klassificeras på annan plats
G63* Polyneuropati vid sjukdomar som klassificeras på annan plats
G73* Neuromuskulära transmissionsrubbningar och muskelförändringar vid sjukdomar
som klassificeras på annan plats
G94* Andra tillstånd i hjärnan vid sjukdomar som klassificeras på annan plats
G99* Andra tillstånd i nervsystemet vid sjukdomar som klassificeras på annan plats
227
INFLAMMATORISKA SJUKDOMAR I
CENTRALA NERVSYSTEMET
(G00-G09)
G01*
Morbi inflammatorii systematis
nervosi centralis
G00
Meningitis in morbis
bacterialibus alibi classificatis
Meningit vid:
• antrax (A22.8†)
• gonokockinfektion (A54.8†)
• infektion orsakad av Borrelia
burgdorferi (A69.2†)
• leptospiros (A27.-†)
• listerios (A32.1†)
• meningokockinfektion (A39.0†)
• neurosyfilis (A52.1†)
• salmonellainfektion (A02.2†)
• syfilis, medfödd (A50.4†)
• syfilis, sekundär (A51.4†)
• tuberkulos (A17.0†)
• tyfoidfeber (A01.0†)
Bakteriell meningit som ej
klassificeras på annan plats
Meningitis bacterialis, non
alibi classificata
Innefattar:
Bakteriell
• araknoidit
• leptomeningit
• meningit
• pakymeningit
Utesluter:
Bakteriell
• meningoencefalit (G04.2)
• meningomyelit (G04.2)
G00.0
Meningit orsakad av
Haemophilus influenzae
G00.1
Meningit orsakad av
pneumokocker
G00.2
Meningit orsakad av
streptokocker
G00.3
Meningit orsakad av
stafylokocker
G00.8
Andra bakteriella meningiter
G00.8A
Meningit, bakteriell, av Escherichia
coli
Utesluter:
Meningoencefalit och
meningomyelit vid
bakteriesjukdomar som
klassificeras på annan plats
(G05.0*)
G02*
Meningit, bakteriell, av Klebsiella
G00.8W
Annan specificerad bakteriell
meningit
G00.9
Bakteriell meningit, ospecificerad
Meningit vid andra
infektions- och
parasitsjukdomar som
klassificeras på annan plats
Meningitis in aliis morbis
infectiosis et parasitariis alibi
classificatis
Utesluter:
Meningoencefalit och
meningomyelit vid andra
infektions- och parasitsjukdomar
som klassificeras på annan plats
(G05.1-G05.2*)
Meningit orsakad av:
• Escherichia coli
• Klebsiella
G00.8B
Meningit vid
bakteriesjukdomar som
klassificeras på annan plats
G02.0*
Meningit vid virussjukdomar
som klassificeras på annan plats
Meningit orsakad av:
• adenovirus (A87.1†)
• enterovirus (A87.0†)
• herpes simplex-virus (B00.3†)
• infektiös mononukleos (B27.-†)
• mässling (B05.1†)
• påssjuka (B26.1†)
• röda hund (B06.0†)
• vattkoppor (B01.0†)
• zoster (B02.1†)
Meningit orsakad av varbildande
bakterier UNS
Varig meningit UNS
228
G02.1*
G02.8*
G04
Meningit vid svampsjukdomar
Meningit vid:
• candidainfektion (B37.5†)
• koccidioidomykos (B38.4†)
• kryptokockos (B45.1†)
Encephalitis, myelitis et
encephalomyelitis
Innefattar:
Akut uppåtstigande myelit
Meningoencefalit
Meningomyelit
Meningit vid andra infektionsoch parasitsjukdomar som
klassificeras på annan plats
Meningit orsakad av:
• afrikansk trypanosomiasis
(B56.-†)
• Chagas sjukdom (kronisk)
(B57.4†)
G03
Utesluter:
Akut transversell myelit (G37.3)
Alkoholencefalopati (G31.2)
Benign myalgisk encefalomyelit
(G93.3)
Encefalopati UNS (G93.4)
Multipel skleros (G35)
Subakut nekrotiserande myelit
(G37.4)
Toxisk encefalopati (G92)
Meningit av andra och
ospecificerade orsaker
Meningitis e causa alia non
specificata
G04.0
Innefattar:
Araknoidit, leptomeningit, meningit
och pakymeningit orsakade av
andra och ospecificerade orsaker
Icke infektiös meningit
G03.1
Kronisk meningit
G03.2
Benign recidiverande meningit
[Mollaret]
G03.8
Meningit av andra specificerade
orsaker
G03.9
Meningit, ospecificerad
Akut disseminerad encefalit
Encefalit och encefalomyelit efter
immunisering eller vaccination
Tilläggskod kan användas för att
identifiera vaccin (kapitel 20)
Utesluter:
Meningoencefalit (G04.-)
Meningomyelit (G04.-)
G03.0
Encefalit, myelit och
encefalomyelit
G04.1
Tropisk spastisk paraplegi
G04.2
Bakteriell meningoencefalit och
meningomyelit som ej
klassificeras på annan plats
G04.2A
Meningoencefalit, bakteriell som ej
klassificeras på annan plats
G04.2B
Meningomyelit, bakteriell som ej
klassificeras på annan plats
G04.8
Annan specificerad encefalit,
myelit och encefalomyelit
Araknoidit (spinal) UNS
Postinfektiös encefalit och
encefalomyelit UNS
Tilläggskod kan användas för att
ange epileptiska anfall (G40.-)
229
G04.8A
Encefalit, postinfektiös
G04.8B
Myelit, postinfektiös
G04.8C
Myelit, akut uppåtstigande
G04.8W
Annan specificerad encefalit och
myelit
G04.9
G05.1*
Encefalit, myelit och
encefalomyelit, ospecificerad
Ventrikulit (cerebral) UNS
G04.9A
Encefalit, ospecificerad
G04.9B
Myelit, ospecificerad
G05*
Encefalit, myelit och
encefalomyelit vid
sjukdomar som
klassificeras på annan plats
Encefalit, myelit eller
encefalomyelit vid:
• adenovirusinfektion (A85.1†)
• cytomegalvirusinfektion
(B25.8†)
• enterovirusinfektion (A85.0†)
• Epstein-Barr-virusinfektion
(B27.0†)
• herpes simplex-infektion
(B00.4†)
• influensa:
• identifierat säsongsvirus
(J10.8†)
• • identifierat zoonotiskt eller
pandemiskt virus (J09†)
• • virus ej identifierat
(J11.8†)
• (J09†, J10.8†, J11.8†)
• mässling (B05.0†)
• påssjuka (B26.2†)
• röda hund (B06.0†)
• vattkoppor (B01.1†)
• zoster (B02.0†)
Encephalitis, myelitis et
encephalomyelitis in morbis
alibi classificatis
Innefattar:
Meningoencefalit och
meningomyelit vid sjukdomar som
klassificeras på annan plats
G05.0*
Encefalit, myelit och
encefalomyelit vid
virussjukdomar som klassificeras
på annan plats
Encefalit, myelit och
encefalomyelit vid
bakteriesjukdomar som
klassificeras på annan plats
Encefalit, myelit eller
encefalomyelit vid:
• listerios (A32.1†)
• meningokockinfektion (A39.8†)
• syfilis, medfödd (A50.4†)
• syfilis, sen (A52.1†)
• tuberkulos (A17.8†)
G05.2*
Encefalit, myelit och
encefalomyelit vid andra
infektions- och parasitsjukdomar
som klassificeras på annan plats
Encefalit, myelit eller
encefalomyelit vid:
• afrikansk trypanosomiasis
(B56.-†)
• Chagas sjukdom (kronisk)
(B57.4†)
• naegleriasis (B60.2†)
• toxoplasmos (B58.2†)
Eosinofil meningoencefalit
(B83.2†)
G05.8*
Encefalit, myelit och
encefalomyelit vid andra
sjukdomar som klassificeras på
annan plats
Encefalit vid systemisk lupus
erythematosus (M32.1†)
230
G06
Abscess och granulom i
skallen och
ryggradskanalen
G07*
Abscessus et granuloma
intracraniale et intraspinale
Abscessus et granuloma
intracraniale et intraspinale in
morbis alibi classificatis
Tilläggskod kan användas för att ange
den infektiösa organismen (B95-B97)
Utesluter:
Postoperativ abscess (T81.4)
G06.0
Hjärnabscess vid:
• amöbainfektion (A06.6†)
• gonokockinfektion (A54.8†)
• tuberkulos (A17.8†)
Schistosomiasisgranulom i hjärnan
(B65.-†)
Tuberkulom i:
• centrala nervsystemets hinnor
(A17.1†)
• hjärnan (A17.8†)
Intrakraniell abscess och
intrakraniellt granulom
Abscess (embolisk) (icke
embolisk):
• cerebellär
• cerebral
• hjärnan UNS
• otogen
Intrakraniell abscess och
intrakraniellt granulom:
• epidural lokalisation
• extradural lokalisation
• subdural lokalisation
G06.1
G08
Intraspinal abscess och
intraspinalt granulom
Intraspinal abscess i halsryggen
G06.1J
Intraspinal abscess i torakalryggen
G06.1K
Intraspinal abscess i ländryggen
G06.1X
Intraspinal abscess med
ospecificerad lokalisation
G06.2
Extradural och subdural abscess,
ospecificerad
Flebit och tromboflebit i
skallens och
ryggradskanalens venösa
hålrum
Phlebitis et trombophlebitis
sinuum venosorum
intracranialium et
intraspinalium
Abscess (embolisk) (icke embolisk)
Intraspinal abscess och intraspinalt
granulom:
• epidural lokalisation
• extradural lokalisation
• subdural lokalisation
G06.1A
Abscess och granulom i
skallen och
ryggradskanalen vid
sjukdomar som
klassificeras på annan plats
Infektiös eller septisk emboli,
endoflebit, flebit, tromboflebit eller
trombos i intrakraniella eller
intraspinala venösa sinus och vener
Utesluter:
Intrakraniell flebit och tromboflebit:
• av icke varig typ (I67.6)
• som komplikation till abort,
extrauteringraviditet och mola
(O00-O07, O08.7)
• som komplikation till graviditet,
förlossning eller barnsängstid
(O22.5, O87.3)
Icke varig intraspinal flebit och
tromboflebit (G95.1)
231
G09
Sena effekter av
inflammatoriska sjukdomar
i centrala nervsystemet
SYSTEMISKA ATROFIER SOM
PRIMÄRT ENGAGERAR CENTRALA
NERVSYSTEMET (G10-G14)
Sequelae tardivae morborum
inflammatoriorum systematis
nervosi centralis
Atrophiae systemicae, praecipue
systematis nervosi centralis
Anmärkning:
G09 används för att ange sena
effekter av tillstånd som primärt
kodas under G00-G08 (utesluter
asteriskkoder). Dessa sena effekter
kan själva också klassificeras på
annan plats. Med ”sena effekter”
avses tillstånd som medicinskt
betraktas som ”sena” eller som
kvarstår ett år eller mer efter
grundsjukdomens början. För
användning av denna kategori
hänvisas till kodningsreglerna för
morbiditet och mortalitet.
G10
Huntingtons sjukdom
Chorea Huntington
Huntingtons korea
G11
Hereditär ataxi (ärftlig
koordinationsrubbning)
Ataxia hereditaria
Utesluter:
Cerebral pares (G80.-)
Hereditär och idiopatisk neuropati
(G60.-)
Ämnesomsättningssjukdomar (E70E90)
G09 skall inte användas för
kroniska inflammatoriska
sjukdomar i centrala nervsystemet.
Sådana tillstånd kodas som aktuella
inflammatoriska sjukdomar i
centrala nervsystemet.
G11.0
Medfödd icke progressiv ataxi
G11.1
Cerebellär ataxi med tidig debut
Tidigt debuterande cerebellär ataxi
med:
• bibehållna senreflexer
• essentiell tremor
• myoklonus [Hunts ataxi]
Friedreichs ataxi (autosomalt
recessiv)
Könsbundet recessiv
spinocerebellär ataxi
Anmärkning:
Debut vanligen före 20 års ålder
G11.2
Cerebellär ataxi med sen debut
Anmärkning:
Debut vanligen efter 20 års ålder
G11.3
Cerebellär ataxi med defekt
DNA-reparation
Ataxia telangiectasia [Louis-Bar]
Utesluter:
Cockaynes syndrom (Q87.1)
Xeroderma pigmentosum (Q82.1)
232
G11.4
Hereditär spastisk parapares
G11.8
Andra specificerade hereditära
ataxier
G11.9
G12
G13*
Hereditär ataxi, ospecificerad
Hereditär cerebellär:
• ataxi UNS
• degeneration
• sjukdom
Hereditärt cerebellärt syndrom
Atrophiae systemicae
imprimis systematis nervosi
centralis in morbis alibi
classificatis
Spinal muskelatrofi och
besläktade syndrom
Atrophia muscularis spinalis
et syndromata cognata
G12.0
Infantil spinal muskelatrofi, typ I
[Werdnig-Hoffman]
G12.1
Annan hereditär spinal
muskelatrofi
G13.0*
G12.1B
G13.1*
G12.1W
G12.2
Motorneuronsjukdom
Andra spinala muskelatrofier och
besläktade syndrom
G12.9
Spinal muskelatrofi,
ospecificerad
G13.2*
Systemisk atrofi som primärt
engagerar centrala nervsystemet
vid myxödem (E00.1†, E03.-†)
G13.8*
Systemisk atrofi som primärt
engagerar centrala nervsystemet
vid andra sjukdomar som
klassificeras på annan plats
G14
Postpoliosyndrom
Syndroma postpolio
Familjär motorneuronsjukdom
Lateralskleros:
• amyotrofisk (ALS)
• primär
Progressiv
• bulbärpares
• spinal muskelatrofi
G12.8
Annan systemisk atrofi som
primärt engagerar centrala
nervsystemet vid
tumörsjukdomar
Paraneoplastisk limbisk
encefalopati (C00-D48†)
Hereditär spinal muskelatrofi,
seninfantil typ II
Hereditär spinal muskelatrofi,
juvenil typ III
Annan hereditär spinal muskelatrofi
Paraneoplastisk neuromyopati
och neuropati
Karcinomatös neuromyopati (C00C97†)
Sensorisk paraneoplastisk neuropati
[Denny Brown] (C00-D48†)
Progressiv bulbärpares hos barn
[Fazio-Londe]
Spinal muskelatrofi:
• adult
• distal
• infantil (kronisk), typ II
• juvenil, typ III [KugelbergWelander]
• skapuloperoneal
G12.1A
Systemiska atrofier som
primärt engagerar centrala
nervsystemet vid
sjukdomar som
klassificeras på annan plats
Postpolio myelitic syndrome
Utesluter:
Sena effekter av polio (B91)
233
BASALGANGLIESJUKDOMAR OCH
RÖRELSERUBBNINGAR (G20-G26)
G23
Morbi extrapyramidales et motorii
G20
Alii morbi degenerativi
gangliorum basalium
Parkinsons sjukdom
Morbus Parkinson
Hemiparkinsonism
Paralysis agitans
Parkinsons sjukdom:
• idiopatisk
• primär
• UNS
G21
Sekundär parkinsonism
Malignt neuroleptikasyndrom
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G21.1
G23.0
Hallervorden-Spatz sjukdom
G23.1
Progressiv supranukleär
oftalmoplegi [Steele-RichardsonOlszewski]
G23.2
Multipel systematrofi,
parkinsontyp [MSA-P]
G23.3
Multipel systematrofi, cerebellar
typ [MSA-C]
G23.8
Andra specificerade degenerativa
sjukdomar i basala ganglierna
Förkalkning i basala ganglierna
Neurogen ortostatisk hypotension
[Shy-Drager]
Annan läkemedelsutlöst
sekundär parkinsonism
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G21.2
Utesluter:
Ortostatisk hypotension UNS
(I95.1)
Sekundär parkinsonism av andra
yttre orsaker
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
G21.3
Postencefalitisk parkinsonism
G21.4
Vaskulär parkinsonism
G21.8
Annan sekundär parkinsonism
G21.9
Sekundär parkinsonism,
ospecificerad
G22*
Pigmentär pallidusdegeneration
Progressiv supranukleär pares
Parkinsonismus secundarius
G21.0
Andra degenerativa
sjukdomar i basala
ganglierna
G23.9
Degenerativ sjukdom i basala
ganglierna, ospecificerad
G24
Dystoni
Dystonia
Innefattar:
Dyskinesi
Utesluter:
Atetoid cerebral pares (G80.3)
G24.0
Parkinsonism vid
sjukdomar som
klassificeras på annan plats
Läkemedelsutlöst dystoni
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Parkinsonismus in morbis
alibi classificatis
Syfilitisk parkinsonism (A52.1†)
G24.1
Idiopatisk familjär dystoni
G24.2
Idiopatisk icke familjär dystoni
G24.3
Spastisk tortikollis
Idiopatisk dystoni UNS
Utesluter:
Tortikollis UNS (M43.6)
234
G25.6
Läkemedelsutlösta tics och andra
tics av organisk orsak
G24.4
Idiopatisk orofacial dystoni
G24.5
Blefarospasm
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G24.8
Andra specificerade dystonier
G24.9
Dystoni, ospecificerad
Utesluter:
Gilles de la Tourettes syndrom
(F95.2)
Tics UNS (F95.9)
G25
Andra basalgangliesjukdomar och
rörelserubbningar
Orofacial dyskinesi
Dyskinesi UNS
G25.8
Akatisi (läkemedelsutlöst)
Restless legs
Stiff man syndrome
Alii morbi extrapyramidales et
motorii
G25.0
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Essentiell tremor
Familjär tremor
Utesluter:
Tremor UNS (R25.1)
G25.1
Läkemedelsutlöst tremor
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G25.2
Andra specificerade former av
tremor
Myoklonus
Läkemedelsutlöst myoklonus
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Utesluter:
Ansiktsmyokymi (G51.4)
Myoklonusepilepsi (G40.-)
G25.4
Läkemedelsutlöst korea
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G25.5
G25.9
Basalgangliesjukdom och
rörelserubbning, ospecificerad
G26*
Basalganglietillstånd och
rörelserubbningar vid
sjukdomar som
klassificeras på annan plats
Conditiones extrapyramidales
et morbi motorii in morbis alibi
classificatis
Intentionstremor
G25.3
Andra specificerade
basalgangliesjukdomar och
rörelserubbningar
Annan korea
Korea UNS
Utesluter:
Huntingtons korea (G10)
Korea UNS med hjärtengagemang
(I02.0)
Reumatisk korea (I02.-)
Sydenhams korea (I02.-)
235
ANDRA DEGENERATIVA
SJUKDOMAR I NERVSYSTEMET
(G30-G32)
Alii morbi degenerativi systematis
nervosi
G30
G31.2
Alkoholutlöst:
• cerebellär:
• ataxi
• degeneration
• cerebral degeneration
• encefalopati
Dysfunktion i autonoma
nervsystemet orsakad av alkohol
Alzheimers sjukdom
Morbus Alzheimer
Innefattar:
Senila och presenila former
Utesluter:
Senil
• degeneration av hjärnan som ej
klassificeras på annan plats
(G31.1)
• demens UNS (F03)
Senilitet UNS (R54)
G30.0
G30.1
Degeneration i nervsystemet
orsakad av alkohol
G31.8
Andra specificerade degenerativa
sjukdomar i nervsystemet
Degeneration av grå substans
[Alpers sjukdom]
Lewykroppsdemens (F02.8*)
Subakut nekrotiserande
encefalopati [Leighs syndrom]
G31.8A
Degenerativa förändringar vid
lewybodydemens
Anmärkning:
Debut vanligen före 65 års ålder
G31.8W
Andra specificerade degenerativa
sjukdomar i nervsystemet
Alzheimers sjukdom med sen
debut
G31.9
Degenerativ sjukdom i
nervsystemet, ospecificerad
G32*
Andra degenerativa
tillstånd i nervsystemet vid
sjukdomar som
klassificeras på annan plats
Alzheimers sjukdom med tidig
debut
Anmärkning:
Debut vanligen efter 65 års ålder
G30.8
Annan specificerad form av
Alzheimers sjukdom
G30.9
Alzheimers sjukdom,
ospecificerad
G31
Andra degenerativa
sjukdomar i nervsystemet
som ej klassificeras på
annan plats
Alii morbi degenerativi
systematis nervosi non alibi
classificati
Aliae conditiones
degenerativae systematis
nervosi in morbis alibi
classificatis
G32.0*
Subakut kombinerad degeneration i
ryggmärgen vid B12-vitaminbrist
(E53.8†)
Utesluter:
Reyes syndrom (G93.7)
G31.0
Lokaliserad hjärnatrofi
G31.1
Senil degeneration av hjärnan
som ej klassificeras på annan
plats
Subakut kombinerad
degeneration i ryggmärgen vid
sjukdomar som klassificeras på
annan plats
G32.8*
Frontotemporal demens
Picks sjukdom
Progressiv isolerad afasi
Utesluter:
Alzheimers sjukdom (G30.-)
Senilitet UNS (R54)
236
Andra specificerade degenerativa
tillstånd i nervsystemet vid
sjukdomar som klassificeras på
annan plats
MYELINFÖRSTÖRANDE
SJUKDOMAR I CENTRALA
NERVSYSTEMET (G35-G37)
G37
Morbi demyelinantes systematis
nervosi centralis
G35
Alii morbi demyelinantes
systematis nervosi centralis
G37.0
Multipel skleros
Sclerosis disseminata
Multipel skleros:
• disseminerad
• generaliserad
• i hjärnstammen
• i ryggmärgen
• UNS
G36
Annan akut utbredd
myelinförstöring
Central demyelinisering av
corpus callosum
G37.2
Central pontin myelinolys
G37.3
Akut transversell myelit vid
demyeliniserande sjukdom i
centrala nervsystemet
Akut transversell myelit UNS
Utesluter:
Multipel skleros (G35)
Neuromyelitis optica [Devic]
(G36.0)
Neuromyelitis optica [Devic]
Demyelinisering vid optikusneurit
Utesluter:
Optikusneurit UNS (H46)
Akut och subakut hemorragisk
leukoencefalit [Hurst]
G36.8
Annan specificerad akut
disseminerad demyelinisering
G36.9
Periaxial encefalit
Schilders sjukdom
G37.1
Utesluter:
Postinfektiös encefalit och
encefalomyelit UNS (G04.8)
G36.1
Diffus skleros
Utesluter:
Adrenoleukodystrofi [AddisonSchilder] (E71.3)
Alia demyelinatio disseminata
acuta
G36.0
Andra myelinförstörande
sjukdomar i centrala
nervsystemet
Akut disseminerad
demyelinisering, ospecificerad
237
G37.4
Subakut nekrotiserande myelit
G37.5
Koncentrisk skleros [Baló]
G37.8
Andra specificerade
demyeliniserande sjukdomar i
centrala nervsystemet
G37.9
Demyeliniserande sjukdom i
centrala nervsystemet,
ospecificerad
EPISODISKA OCH PAROXYSMALA
SJUKDOMAR (G40-G47)
G40.2
Morbi episodici et paroxysmales
G40
Attacker med medvetandegrumling,
ofta med automatismer
Komplexa partiella anfall med
sekundär generalisering
Psykomotoriska anfall
Epilepsi
Epilepsia
G40.0
Partiell (fokal) symtomatisk
epilepsi och epileptiska syndrom
med komplexa partiella anfall
Utesluter:
Feberkramper (R56.0)
Krampanfall UNS (R56.8)
Landau-Kleffners syndrom (F80.3)
Status epilepticus (G41.-)
Todds paralys (G83.8)
G40.2A
Temporallobsepilepsi, partiell,
komplex, med medvetandestörning,
G40.2B
Frontallobsepilepsi, partiell,
komplex, med medvetandestörning,
Partiell (fokal) idiopatisk epilepsi
och epileptiska syndrom med
lokal början
G40.2C
Parietallobsepilepsi, partiell,
komplex, med medvetandestörning,
G40.2D
Occipitallobsepilepsi, partiell,
komplex, med medvetandestörning,
G40.2E
Partiell epilepsi, komplex, med
medvetandestörning, med sekundär
generalisering
G40.2F
Partiell epilepsi, komplex, med
medvetandestörning,
psykomotorisk
G40.2X
Partiell epilepsi, komplex, med
medvetandestörning, ospecificerad
G40.3
Generaliserad idiopatisk epilepsi
och epileptiska syndrom
Benign barnepilepsi med
centrotemporala EEG-spikes
Barnepilepsi med occipitala EEGparoxysmer
G40.0A
Benign barnepilepsi
G40.0B
Barnepilepsi med occipitala EEGparoxysmer
G40.0W
Annan fokal, partiell, idiopatisk
epilepsi
G40.1
Partiell (fokal) symtomatisk
epilepsi och epileptiska syndrom
med enkla partiella anfall
Attacker utan medvetandepåverkan
Enkla partiella anfall med sekundär
generalisering
Absenser hos barn [pyknolepsi]
Benign myoklonisk epilepsi hos
barn
Benigna nyföddhetskramper
(familjära)
Ej specifika epileptiska anfall:
• atoniska
• kloniska
• myokloniska
• toniska
• tonisk-kloniska
Epilepsi med grand mal vid
uppvaknandet (efter sömn)
Juvenil:
• absensepilepsi
• myoklonisk epilepsi
Progressiv myoklonusepilepsi
G40.1A
Temporallobsepilepsi, partiell,
enkel, utan medvetandestörning
G40.1B
Frontallobsepilepsi, partiell, enkel,
utan medvetandestörning
G40.1C
Parietallobsepilepsi, partiell, enkel,
utan medvetandestörning
G40.1D
Occipitallobsepilepsi, partiell,
enkel, utan medvetandestörning
G40.1E
Partiell epilepsi, enkel, utan
medvetandestörning med sekundär
generalisering
G40.3A
Barnepilepsi, med absenser, petit
mal (pyknolepsi)
Partiell epilepsi, enkel, utan
medvetandestörning, ospecificerad
G40.3B
Juvenil absensepilepsi
G40.1X
238
G40.3C
Juvenil myoklon epilepsi
G40.3D
Benigna neonatala kramper med
eller utan hereditet
G40.3E
G40.3F
G40.8
Annan epilepsi
Benign myoklon epilepsi hos
spädbarn
G40.9
Epilepsi, ospecificerad
Epilepsi med grand mal efter
uppvaknande
G41
Status epilepticus
G40.3X
Primärt generaliserad idiopatisk
epilepsi, ospecificerad
G41.0
G40.4
Annan generaliserad epilepsi och
andra epileptiska syndrom
Infantil spasm, Wests syndrom
G40.4B
Myoklonisk-astatiska anfall,
Lennox-Gastauts syndrom
G40.4C
Myoklona absenser
G40.4D
Atypiska absenser
G40.4X
Generaliserad symtomatisk
epilepsi, ospecificerad
G40.5
Speciella epileptiska syndrom
G40.7
Status epilepticus av grand maltyp
Tonisk-kloniskt status epilepticus
Utesluter:
Epilepsia partialis continua (G40.5)
G41.1
Status epilepticus av petit mal-typ
G41.2
Status epilepticus med komplexa
partiella anfall
G41.8
Annat specificerat status
epilepticus
G41.9
Status epilepticus, ospecificerat
G43
Migrän
Epileptiskt absensstatus
Hemicrania
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Utesluter:
Huvudvärk UNS (R51)
Epilepsia partialis continua
Epileptiska anfall relaterade till:
• alkohol
• hormonella förändringar
• läkemedel
• stress
• sömndeprivation
G43.0
Migrän utan aura [vanlig
migrän]
G43.1
Migrän med aura [klassisk
migrän]
Aura utan huvudvärk
Basilarismigrän
Familjär hemiplegisk migrän
Migränekvivalenter
Migrän med akut uppträdande aura
Migrän med utdragen aura
Migrän med typisk aura
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G40.6
Epileptiska anfall UNS
Status epilepticus
Epilepsi med:
• myokloniska absenser
• myoklonisk-astatiska anfall
Infantil spasm
Lennox-Gastauts syndrom
Salaamattacker
Symtomatisk tidig myoklonisk
encefalopati
Wests syndrom
G40.4A
Epilepsier och epileptiska syndrom,
osäkert om partiella eller
generaliserade
Grand mal-anfall, ospecificerat
(med eller utan absenser)
G43.2
Status hemicranicus
G43.3
Komplicerad migrän
Absenser, ospecificerade, utan
grand mal-anfall
239
Ihållande migrän
Status migrainosus
G43.8
Annan specificerad migrän
G45.0
Oftalmoplegisk migrän
Retinal migrän
G43.9
Migrän, ospecificerad
G44
Andra huvudvärkssyndrom
Transitorisk ischemisk attack inom
försörjningsområdet för arteria
vertebralis och arteria basilaris
G45.1
Arteria carotis-syndrom
G45.2
Multipla och bilaterala
precerebrala artärsyndrom
G45.3
Amaurosis fugax
G45.4
Transitorisk global amnesi
Alia syndromata cephalalgica
Utesluter:
Atypisk ansiktssmärta (G50.1)
Huvudvärk UNS (R51)
Trigeminusneuralgi (G50.0)
G44.0
G44.1
Syndrom med cluster headache
Cluster headache [Hortons
syndrom]
• episodisk
• kronisk
Kronisk paroxysmal hemikrani
Vaskulär huvudvärk som ej
klassificeras på annan plats
G45.8
Annan transitorisk cerebral
ischemi och besläktade syndrom
G45.9
Transitorisk cerebral ischemisk
attack, ospecificerad
Spänningshuvudvärk
Spasm i cerebral artär
Transitorisk ischemisk attack UNS
Episodisk spänningshuvudvärk
Kronisk spänningshuvudvärk
Spänningshuvudvärk UNS
G44.3
Kronisk posttraumatisk
huvudvärk
G44.4
Läkemedelsutlöst huvudvärk som
ej klassificeras på annan plats
G46*
G45
Vaskulära syndrom i
hjärnan vid
cerebrovaskulära
sjukdomar (I60-I67†)
Syndromata vascularia
cerebralia in morbis
cerebrovascularibus
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G44.8
Transitorisk ischemisk attack inom
försörjningsområdet för arteria
carotis
Utesluter:
Amnesi UNS (R41.3)
Vaskulär huvudvärk UNS
G44.2
Arteria vertebrobasilarissyndrom
Andra specificerade
huvudvärkssyndrom
Övergående cerebral
ischemi (otillräcklig
blodtillförsel till hjärnan)
och besläktade syndrom
Ischaemia cerebralis
transitoria et syndromata
cognata
G46.0*
Arteria cerebri media-syndrom
(I66.0†)
G46.1*
Arteria cerebri anterior-syndrom
(I66.1†)
G46.2*
Arteria cerebri posteriorsyndrom (I66.2†)
G46.3*
Cerebrovaskulärt
hjärnstamssyndrom (I60-I67†)
Syndrom:
• Benedikt
• Claude
• Foville
• Millard-Gubler
• Wallenberg
• Weber
Innefattar:
Transitorisk ischemisk attack [TIA]
Utesluter:
Neonatal cerebral ischemi (P91.0)
240
G46.4*
Cerebrovaskulärt
lillhjärnssyndrom (I60-I67†)
G46.5*
Isolerat motoriskt lakunärt
syndrom (I60-I67†)
G46.6*
Isolerat sensoriskt lakunärt
syndrom (I60-I67†)
G46.7*
Andra lakunära syndrom (I60I67†)
G46.8*
Andra vaskulära syndrom i
hjärnan vid cerebrovaskulära
sjukdomar (I60-I67†)
G47
SJUKDOMAR I NERVER,
NERVRÖTTER OCH NERVPLEXUS
(G50-G59)
Morbi nervorum, radicum et
plexuum nervorum
Utesluter:
Aktuella traumatiska skador i nerver, nervrötter
och nervplexus - se nervskada efter kroppsdel
(Kapitel 19)
Neuralgi och neurit UNS (M79.2)
Perifer neuropati vid graviditet (O26.8)
Radikulit UNS (M54.1)
G50
Sömnstörningar
Morbi nervi trigemini
Perturbationes somni
Utesluter:
Icke organiska sömnstörningar
(F51.-)
Mardrömmar (F51.5)
Nattskräck (F51.4)
Sömngång (F51.3)
G47.0
Insomni (insomningsstörningar
och avkortad nattsömn)
G47.1
Hypersomni (överdriven
sömnighet)
G47.2
G47.3
G50.0
Trigeminusneuralgi
G50.1
Atypisk ansiktssmärta
G50.8
Andra specificerade sjukdomar i
trigeminusnerven
G50.9
Sjukdom i trigeminusnerven,
ospecificerad
G51
Sjukdomar i facialisnerven
Tic douloureux
Morbi nervi facialis
Dygnsrytmstörningar
Framåtförskjuten sömnfas
Fördröjd sömnfas
Oregelbunden dygnsrytm
Sömnapnésyndrom
Central sömnapné
Obstruktiv sömnapné
G51.0
Bells pares
G51.1
Genikulatumganglionit
Ansiktsförlamning
Facialispares
Utesluter:
Postherpetisk
genikulatumganglionit (G53.0*,
B02.2†)
Utesluter:
Periodisk andning (R06.3)
Pickwicksyndromet (E66.2)
Sömnapné hos nyfödd (P28.3)
G51.2
Melkerssons syndrom
Andra specificerade
sömnstörningar
G51.3
Facialishemispasm
G51.4
Ansiktsmyokymi
Sömnstörning, ospecificerad
G51.8
Andra specificerade sjukdomar i
facialisnerven
G51.9
Sjukdom i facialisnerven,
ospecificerad
G47.4
Narkolepsi och kataplexi
G47.8
Kleine-Levins syndrom
G47.9
Sjukdomar i
trigeminusnerven
241
Melkersson-Rosenthals syndrom
G52
Sjukdomar i andra
kranialnerver
G53.3*
Multipla kranialnervspareser vid
tumörsjukdomar (C00-D48†)
Morbi aliorum nervorum
cranialium
G53.8*
Andra kranialnervsförändringar
vid andra sjukdomar som
klassificeras på annan plats
G54
Sjukdomar i nervrötter och
nervplexus
Utesluter:
Paralytisk strabism orsakad av
nervförlamning (H49.0-H49.2)
Sjukdomar i nervus statoacusticus
(H93.3)
Sjukdomar i nervus opticus (H46,
H47.0)
G52.0
Sjukdomar i nervus olfactorius
G52.1
Sjukdomar i nervus
glossopharyngeus
Morbi radicum et plexuum
nervorum
Utesluter:
Traumatiska skador på nervrötter
och nervplexus, se nervskada efter
kroppsdel
Tillstånd beroende på:
• brakial, lumbal, lumbosakral
eller torakal neuropati UNS
(M54.1)
• brakial, lumbal, lumbosakral
eller torakal radikulit UNS
(M54.1)
• neuralgi eller neurit UNS
(M79.2)
• radikulopati UNS (M54.1)
• radikulit UNS (M54.1)
• sjukdomar i mellankotskivorna
(M50-M51)
• spondylos (M47.-)
Glossofaryngeusneuralgi
G52.2
Sjukdomar i nervus vagus
G52.3
Sjukdomar i nervus hypoglossus
G52.7
Sjukdomar i multipla
kranialnerver
Polyneuritis cranialis
G52.8
Sjukdomar i andra specificerade
kranialnerver
G52.9
Kranialnervssjukdom,
ospecificerad
G53*
G53.0*
G54.0
Sjukdomar i brakialplexus
G54.1
Sjukdomar i lumbosakralplexus
G54.2
Sjukdomar i cervikalrot som ej
klassificeras på annan plats
Morbi nervorum cranialium in
morbis alibi classificatis
G54.3
Sjukdomar i torakalrot som ej
klassificeras på annan plats
Neuralgi efter zoster-infektion
(B02.2†)
G54.4
Sjukdomar i lumbosakralrot som
ej klassificeras på annan plats
G54.5
Neuralgisk amyotrofi
Multipla kranialnervspareser vid
infektions- och parasitsjukdomar
som klassificeras på annan plats
(A00-B99†)
G54.6
Fantom-extremitetssyndrom med
smärta
Multipla kranialnervspareser vid
sarkoidos (D86.8†)
G54.7
Förändringar i
kranialnerver vid
sjukdomar som
klassificeras på annan plats
Postherpetisk:
• genikulatumganglionit
• trigeminusneuralgi
G53.1*
G53.2*
Toraxapertursyndrom
Parsonage-Aldren-Turners syndrom
Skulderneurit
Fantomsmärta
Fantom-extremitetssyndrom utan
smärta
Fantom-extremitetssyndrom UNS
242
G54.8
Andra specificerade sjukdomar i
nervrötter och nervplexus
G54.9
Sjukdom i nervrötter och
nervplexus, ospecificerad
G55*
Kompression av nervrötter
och nervplexus vid
sjukdomar som
klassificeras på annan plats
G56
Mononeuropati (sjukdom i
en enda perifer nerv) i övre
extremitet
Mononeuropathia extremitatis
superioris
Utesluter:
Aktuell traumatisk nervskada, se
nervskada efter kroppsdel
G56.0
Karpaltunnelsyndrom
G56.1
Andra lesioner av nervus
medianus
G56.2
Lesion av nervus ulnaris
G56.2B
Ulnarisentrapment i
axelled/överarm
G56.2C
Ulnarisentrapment i
armbåge/underarm
G56.2D
Ulnarisentrapment i handled/hand
G56.2X
Ulnarisentrapment med
ospecificerad lokalisation
G56.3
Lesion av nervus radialis
G56.3B
G55.0X* Kompression av nervrötter och
nervplexus med ospecificerad
lokalisation vid tumörsjukdom
Radialisentrapment i
axelled/överarm
G56.3C
Radialisentrapment i
armbåge/underarm
G55.1*
G56.3D
Radialisentrapment i handled/hand
G56.3X
Radialisentrapment med
ospecificerad lokalisation
G56.4
Kausalgi
G56.8
Andra specificerade
mononeuropatier i övre
extremitet
G56.9
Mononeuropati i övre extremitet,
ospecificerad
Compressio radicum et
plexuum nervorum in morbis
alibi classificatis
G55.0*
Kompression av nervrötter och
nervplexus vid tumörsjukdomar
(C00-D48†)
G55.0A* Kompression av nervrötter och
nervplexus i halsryggen vid
tumörsjukdom
G55.0J*
Kompression av nervrötter och
nervplexus i torakalryggen vid
tumörsjukdom
G55.0K* Kompression av nervrötter och
nervplexus i ländryggen vid
tumörsjukdom
G55.2*
G55.3*
G55.8*
Kompression av nervrötter och
nervplexus vid sjukdomar i
mellankotskivorna (M50-M51†)
Kompression av nervrötter och
nervplexus vid spondylos
(M47.-†)
Kompression av nervrötter och
nervplexus vid andra
ryggåkommor (M45-M46†,
M48.-†, M53-M54†)
Kompression av nervrötter och
nervplexus vid andra sjukdomar
som klassificeras på annan plats
243
G57
Mononeuropati (sjukdom i
en enda perifer nerv) i
nedre extremitet
G59*
Mononeuropathia extremitatis
inferioris
Mononeuropathia in morbis
alibi classificatis
Utesluter:
Aktuell traumatisk nervskada, se
nervskada efter kroppsdel
G57.0
Lesion av nervus ischiadicus
Utesluter:
Ischias orsakad av sjukdom i
mellankotskiva (M51.1)
Ischias UNS (M54.3)
G57.1
Meralgia paraesthetica
G57.2
Lesion av nervus femoralis
G57.3
Lesion av nervus fibularis
G57.4
Lesion av nervus tibialis
G57.5
Tarsaltunnelsyndrom
G57.6
Lesion av nervus plantaris
G57.8
Andra specificerade
mononeuropatier i nedre
extremitet
G57.9
Mononeuropati i nedre
extremitet, ospecificerad
G58
Andra mononeuropatier
(sjukdomar i en enda
perifer nerv)
Lesion av nervus cutaneus femoris
lateralis
Peroneuspares
Mortons metatarsalgi
Aliae mononeuropathiae
G58.0
Interkostalneuropati
G58.7
Mononeuropathia multiplex
G58.8
Andra specificerade
mononeuropatier
G58.9
Mononeuropati, ospecificerad
Mononeuropati (sjukdom i
en enda perifer nerv) vid
sjukdomar som
klassificeras på annan plats
244
G59.0*
Diabetisk mononeuropati (E10E14† med fjärdepositionen .4)
G59.8*
Andra mononeuropatier vid
sjukdomar som klassificeras på
annan plats
POLYNEUROPATIER (SAMTIDIG
SJUKDOM I FLERA PERIFERA
NERVER) OCH ANDRA
SJUKDOMAR I PERIFERA
NERVSYSTEMET (G60-G64)
G61
Polyneuropathiae et alii morbi
systematis nervosi peripherici
Polyneuropathia
inflammatoria
Utesluter:
Neuralgi och neurit UNS (M79.2)
Perifer neuropati vid graviditet (O26.8)
Radikulit UNS (M54.1)
G60
Hereditär och idiopatisk
neuropati (sjukdom i perifer
nerv, ärftlig och av okänd
orsak)
Hereditär motorisk och sensorisk
neuropati
Charcot-Marie-Tooths sjukdom
Déjerine-Sottas sjukdom
Hereditär motorisk och sensorisk
(perifer) neuropati, typ I-IV
Hypertrofisk neuropati i barndomen
Peroneal muskelatrofi:
• axonal typ
• hypertrofisk typ
Roussy-Lévys syndrom
G60.1
Refsums sjukdom
G60.2
Neuropati i samband med
hereditär ataxi
G60.3
Idiopatisk progressiv neuropati
G60.8
Andra specificerade hereditära
och idiopatiska neuropatier
Guillain-Barrés syndrom
G61.1
Serumneuropati
Akut inflammatorisk
poly(radikulo)neuropati
Miller Fishers syndrom
G61.8
Andra specificerade
inflammatoriska polyneuropatier
G61.9
Inflammatorisk polyneuropati,
ospecificerad
G62
Andra polyneuropatier
(sjukdomar i flera perifera
nerver samtidigt)
Aliae polyneuropathiae
G62.0
Läkemedelsutlöst polyneuropati
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
G62.1
Alkoholutlöst polyneuropati
G62.2
Polyneuropati orsakad av andra
toxiska ämnen
Tilläggskod kan användas för att ange
det toxiska ämnet (kapitel 20)
G62.8
Morvans sjukdom
Nelatons syndrom
Sensorisk neuropati:
• dominant ärftlig typ
• recessivt ärftlig typ
G60.9
G61.0
Tilläggskod kan användas för att ange
orsak (kapitel 20)
Neuropathia hereditaria et
idiopathica
G60.0
Inflammatorisk
polyneuropati
(inflammatorisk sjukdom i
flera perifera nerver
samtidigt)
Andra specificerade
polyneuropatier
Strålningsutlöst polyneuropati
Tilläggskod kan användas för att ange
orsak (kapitel 20)
Hereditär och idiopatisk
neuropati, ospecificerad
G62.9
¨
245
Polyneuropati, ospecificerad
Neuropati UNS
G63*
G63.0*
Polyneuropati (sjukdom i
flera perifera nerver
samtidigt) vid sjukdomar
som klassificeras på annan
plats
Polyneuropathia in morbis
alibi classificatis
NEUROMUSKULÄRA
TRANSMISSIONSRUBBNINGAR
(RUBBNINGAR I ÖVERFÖRING AV
IMPULSER MELLAN NERVER OCH
MUSKLER) OCH SJUKDOMAR I
MUSKLER (G70-G73)
Morbi myoneurales et musculares
Polyneuropati vid infektions- och
parasitsjukdomar som
klassificeras på annan plats
G70
Polyneuropati vid:
• difteri (A36.8†)
• infektion med Borrelia
burgdorferi (A69.2†)
• infektiös mononukleos (B27.-†)
• lepra (A30.-†)
• påssjuka (B26.8†)
• syfilis, sen medfödd (A50.4†)
• syfilis, sen (A52.1†)
• tuberkulos (A17.8†)
• zoster (B02.2†)
G63.1*
Polyneuropati vid tumörsjukdom
(C00-D48†)
G63.2*
Diabetisk polyneuropati (E10E14† med fjärdepositionen .4)
G63.3*
Polyneuropati vid andra
endokrina och metaboliska
sjukdomar (E00-E07†, E15-E16†,
E20-E34†, E70-E89†)
Myasthenia gravis och
andra neuromuskulära
transmissionsrubbningar
(rubbningar i överföring av
impulser mellan nerver och
muskler)
Myasthenia gravis et alii
morbi myoneurales
Utesluter:
Botulism (A05.1)
Transitorisk neonatal myasthenia
gravis (P94.0)
G70.0
Myasthenia gravis
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20), om
läkemedelsutlöst
G70.1
Toxiska neuromuskulära
transmissionsrubbningar
Tilläggskod kan användas för att ange
det toxiska ämnet (kapitel 20)
G63.4*
Polyneuropati vid
näringsbristtillstånd (E40-E64†)
G70.2
G63.5*
Polyneuropati vid systemiska
bindvävssjukdomar (M30-M35†)
Medfödd och
utvecklingsrelaterad myasteni
G70.8
G63.6*
Polyneuropati vid andra
muskuloskeletala sjukdomar
(M00-M25†, M40-M96†)
Andra specificerade
neuromuskulära
transmissionsrubbningar
G70.9
Neuromuskulär
transmissionsrubbning,
ospecificerad
G63.8*
Polyneuropati vid andra
sjukdomar som klassificeras på
annan plats
Uremisk neuropati (N18.5†)
G64
Andra sjukdomar i perifera
nervsystemet
Alii morbi systematis nervosi
peripherici
Sjukdomar i perifera nervsystemet
UNS
246
G71
Primära muskelsjukdomar
G71.2
Medfödda myopatier
G71.3
Mitokondriell myopati som ej
klassificeras på annan plats
G71.8
Andra specificerade primära
muskelsjukdomar
G71.9
Primär muskelsjukdom,
ospecificerad
Morbi musculares primarii
Utesluter:
Arthrogryposis multiplex congenita
(Q74.3)
Metaboliska sjukdomar (E70-E90)
Myosit (M60.-)
G71.0
Muskeldystrofi
Muskeldystrofi:
• autosomalt recessiv, hos barn,
liknande Duchenne eller Becker
• benign [Becker]
• benign skapuloperoneal med
tidiga kontrakturer [EmeryDreifuss]
• distal [Welander]
• facioskapulohumeral
• i skulder-bäckengördel
• okulär
• okulofaryngeal
• skapuloperoneal
• svår [Duchenne]
Hereditär myopati UNS
G72
Utesluter:
Medfödd muskeldystrofi:
• med specificerade morfologiska
abnormiteter i muskelfibrer
(G71.2)
• UNS (G71.2)
G71.0A
Muskeldystrofi, hereditär, typ
Duchenne
G71.0B
Muskeldystrofi, hereditär, typ
Becker (benign)
G71.0W
Annan specificerad muskeldystrofi
G71.0X
Muskeldystrofi, (ej medfödd),
ospecificerad
G71.1
Myotona sjukdomar
Fibre-type disproportion
Medfödd muskeldystrofi:
• med specificerade morfologiska
abnormiteter i muskelfibrer
• UNS
Medfödd myopati:
• central core disease
• minicore disease
• multicore disease
Myotubulär myopati
Nemalinkroppsmyopati
Andra myopatier
Aliae myopathiae
Utesluter:
Arthrogryposis multiplex congenita
(Q74.3)
Dermatopolymyosit (M33.-)
Ischemisk muskelinfarkt (M62.2)
Myosit (M60.-)
Polymyosit (M33.2)
G72.0
Läkemedelsutlöst myopati
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20)
Dystrophia myotonica [Steinert]
Myotoni:
• kondrodystrofisk
• läkemedelsutlöst
• symtomatisk
Myotonia congenita:
• dominant [Thomsen]
• recessiv [Becker]
• UNS
Neuromyotoni [Isaacs]
Paramyotonia congenita
Pseudomyotoni
G72.1
Alkoholutlöst myopati
G72.2
Myopati orsakad av annat toxiskt
ämne
Tilläggskod kan användas för att ange
det toxiska ämnet (kapitel 20)
Tilläggskod kan användas för att ange
orsakande läkemedel (kapitel 20), om
läkemedelsutlöst
247
G72.3
Periodisk paralys
G72.3A
Hypokalemisk periodisk paralys
G72.3B
Hyperkalemisk periodisk paralys
Periodisk paralys (familjär):
• hyperkalemisk
• hypokalemisk
• myoton
• normokalemisk
G72.4
Inflammatorisk myopati som ej
klassificeras på annan plats
G72.8
Andra specificerade myopatier
G72.9
Myopati, ospecificerad
G73*
Neuromuskulära
transmissionsrubbningar
(rubbningar i överföringen
av impulser mellan nerver
och muskler) och
muskelförändringar vid
sjukdomar som
klassificeras på annan plats
G73.7*
Myopati vid:
• reumatoid artrit (M05-M06†)
• siccasyndromet [Sjögrens
syndrom] (M35.0†)
• sklerodermi (M34.8†)
• systemisk lupus erythematosus
(M32.1†)
Morbi myoneurales et
musculares in morbis alibi
classificatis
G73.0*
Myastena syndrom vid endokrina
sjukdomar
Myastena syndrom vid:
• diabetisk amyotrofi (E10-E14†
med fjärdeposition .4)
• tyreotoxikos (E05.-†)
G73.1*
Lambert- Eatons syndrom (C00D48†)
G73.2*
Andra myastena syndrom vid
tumörsjukdomar (C00-D48†)
G73.3*
Myastena syndrom vid andra
sjukdomar som klassificeras på
annan plats
G73.4*
Myopati vid infektions- och
parasitsjukdomar som
klassificeras på annan plats (A00B99†)
G73.5*
Myopati vid endokrina
sjukdomar
Myopati vid:
• hyperparatyreoidism (E21.0E21.3†)
• hypoparatyreoidism (E20.-†)
Tyreotoxisk myopati (E05.-†)
G73.6*
Myopati vid andra sjukdomar
som klassificeras på annan plats
Myopati vid metaboliska
sjukdomar
Myopati vid:
• glykogeninlagringssjukdom
(E74.0†)
• fettupplagringssjukdom (E75.-†)
248
CEREBRAL PARES OCH ANDRA
FÖRLAMNINGSSYNDROM
(G80-G83)
G80.8
Blandade syndrom med cerebral
pares
Spastisk monoplegi vid cerebral
pares
Paresis cerebralis et alia
syndromata paralytica
G80
G80.0
Annan specificerad form av
cerebral pares
G80.8B
Cerebral pares, monopares
Paralysis cerebralis
G80.8C
Cerebral pares, blandade syndrom
Utesluter:
Hereditär spastisk parapares
(G11.4)
G80.8W
Cerebral pares, annan specificerad
form
G80.9
Cerebral pares, ospecificerad
G81
Ensidig förlamning
Cerebral pares
Spastisk tetraplegisk cerebral
pares
G80.1
Spastisk diplegisk cerebral pares
G80.1A
Cerebral pares, diplegi, spastisk,
hos prematura
G80.1B
Cerebral pares, diplegi, spastisk,
hos fullgångna
G80.1X
Cerebral pares, spastisk diplegi,
ospecificerad
G80.2
Spastisk hemiplegisk cerebral
pares
Anmärkning:
Som primärkod används
kodnummer under G81 endast för
hemiplegi utan närmare
specifikation eller hemiplegi som
betecknas som ”gammal” eller
sedan lång tid bestående men utan
angiven orsak. Om
grundsjukdomen är känd anges
denna som primärkod; kodnummer
G81 kan då användas som
tilläggskod för att ange typ av
hemiplegi
G80.3
Dyskinetisk cerebral pares
Utesluter:
Medfödd cerebral pares (G80.-)
G80.3A
Hemiplegia
Spastisk cerebral pares UNS
Atetoid cerebral pares
Dyston cerebral pares
(tonusväxlingssyndrom)
Cerebral pares, dyston,
tonusväxlingssyndrom
G80.3B
Cerebral pares, atetoid
G80.3X
Dyskinetisk cerebral pares,
ospecificerad
G80.4
Ataktisk cerebral pares
G80.4A
Cerebral pares, dysekvilibriumataxi
G80.4W
Annan ataktisk cerebral pares
249
G81.0
Slapp hemipares
G81.1
Spastisk hemipares
G81.9
Hemipares, ospecificerad
Hemiplegi UNS
G82
Parapares och tetrapares
(förlamning av båda nedre
extremiteterna och
förlamning av alla fyra
extremiteterna)
G83
Alia syndromata paralytica
Anmärkning:
Som primärkod används
kodnummer under G83 endast när
angivna tillstånd inte specificeras
närmare eller betecknas som
”gamla” eller sedan lång tid
bestående men utan angiven orsak.
Om grundsjukdomen är känd anges
denna som primärkod; kodnummer
under G83 kan då användas som
tilläggskod för att ange typ av
förlamning
Paraplegia et tetraplegia
Anmärkning:
Som primärkod används
kodnummer under G82 endast när
angivna tillstånd är utan närmare
specifikation eller betecknas som
”gamla” eller sedan lång tid
bestående men utan angiven orsak.
Om grundsjukdomen är känd anges
denna som primärkod; kodnummer
under G82 kan då användas som
tilläggskod för att ange typ av
förlamning
Innefattar:
Förlamning utom de former som
klassificeras under G80-G82
Utesluter:
Medfödd cerebral pares (G80.-)
G82.0
Slapp parapares
G82.1
Spastisk parapares
G82.2
Parapares, ospecificerad
Pares av båda nedre extremiteterna
UNS
Paraplegi UNS
G82.3
Slapp tetrapares
G82.4
Spastisk tetrapares
G82.5
Tetrapares, ospecificerad
Andra förlamningssyndrom
G83.0
Dipares i övre extremiteterna
G83.1
Monopares i nedre extremitet
G83.2
Monopares i övre extremitet
G83.3
Ospecificerad monopares
G83.4
Cauda equina-syndrom
Quadriplegi UNS
Tetraplegi UNS
Diplegi UNS
Förlamning av båda övre
extremiteterna
Förlamning av en nedre extremitet
Förlamning av en övre extremitet
Monoplegi UNS
Neurogen claudicatio intermittens
Neurogen störning i
sfinkterfunktionen hos tarm och
blåsa
Utesluter:
Spinal reflexblåsa UNS (G95.8)
G83.5
Locked-in-syndrome
G83.8
Andra specificerade
förlamningssyndrom
Todds paralys (postepileptisk
förlamning)
G83.9
250
Förlamningssyndrom,
ospecificerade
ANDRA SJUKDOMAR I
NERVSYSTEMET (G90-G99)
G91.3
Posttraumatisk hydrocefalus,
ospecificerad
Alii morbi systematis nervosi
G91.8
Annan specificerad hydrocefalus
G90
Sjukdomar i autonoma
nervsystemet
G91.8A
Hydrocefalus med
ventrikeldilatation
Morbi systematis nervosi
autonomici
G91.8B
Posthemorragisk hydrocefalus
G91.8W
Annan specificerad ej medfödd
hydrocefalus
G91.9
Hydrocefalus, ospecificerad
G92
Toxisk encefalopati
(hjärnsjukdom)
Utesluter:
Dysfunktion i autonoma
nervsystemet orsakad av alkohol
(G31.2)
G90.0
Idiopatisk perifer autonom
neuropati
Sinus caroticus-synkope
G90.1
Familjär dysautonomi [RileyDay]
G90.2
Horners syndrom
G90.4
Autonom dysreflexi
G90.8
Andra specificerade sjukdomar i
autonoma nervsystemet
G90.9
Sjukdom i autonoma
nervsystemet, ospecificerad
G91
Hydrocefalus (vattenskalle,
ökad mängd
hjärnkammarvatten)
Encephalopathia toxica
Tilläggskod kan användas för att ange
det toxiska ämnet (kapitel 20)
G93
Bernard(-Horners) syndrom
Alii morbi cerebrales
G93.0
G93.1
Utesluter:
Medfödd hydrocefalus (Q03.-)
Förvärvad hydrocefalus hos nyfödd
(P91.7)
Hydrocefalus orsakad av medfödd
toxoplasmos (P37.1)
G91.1
Obstruktiv hydrocefalus
G91.2
Normaltryckshydrocefalus
Araknoidalcysta
Porencefalcysta, förvärvad
Anoxisk hjärnskada som ej
klassificeras på annan plats
Utesluter:
Hjärnskada som komplikation till
abort, extrauteringraviditet eller
mola (O00-O07, O08.8)
Hjärnskada som komplikation till
graviditet, värkarbete eller
förlossning (O29.2, O74.3, O89.2)
Hjärnskada hos nyfödd (P21.9)
Hjärnskada som komplikation till
medicinsk och kirurgisk vård (T80T88)
Innefattar:
Förvärvad hydrocefalus
Kommunicerande hydrocefalus
Hjärncystor
Utesluter:
Förvärvade periventrikulära cystor
hos nyfödda (P91.1)
Medfödda cerebrala cystor (Q04.6)
Hydrocephalus
G91.0
Andra sjukdomar i hjärnan
G93.2
Benign intrakraniell
hypertension
Utesluter:
Hypertensiv encefalopati (I67.4)
Lågtryckshydrocefalus
251
G93.3
Trötthetssyndrom efter
virusinfektion
G94.2*
Hydrocefalus vid andra
sjukdomar som klassificeras på
annan plats
G94.8*
Andra specificerade tillstånd i
hjärnan vid sjukdomar som
klassificeras på annan plats
G95
Andra sjukdomar i
ryggmärgen
Benign myalgisk encefalomyelit
Innefattar:
Kroniskt trötthetssyndrom
G93.4
Encefalopati, ospecificerad
Utesluter:
Alkoholencefalopati (G31.2)
Toxisk encefalopati (G92)
G93.5
Hjärnkompression
Alii morbi medullae spinalis
Kompression eller inklämning av
hjärnan eller hjärnstammen
Utesluter:
Myelit (G04.-)
Utesluter:
Traumatisk kompression av
hjärnan:
• diffus (S06.2)
• fokal (S06.3)
G93.6
G95.0
Syringomyeli och syringobulbi
G95.1
Vaskulära myelopatier
Hjärnödem
Utesluter:
Hjärnödem orsakat av
förlossningsskada (P11.0)
Traumatiskt hjärnödem (S06.1)
G93.7
Utesluter:
Intraspinal flebit och tromboflebit,
utom icke varig (G08)
Reyes syndrom
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
G93.8
Andra specificerade sjukdomar i
hjärnan
Encefalopati efter strålning
G95.2
Ryggmärgskompression,
ospecificerad
G95.8
Andra specificerade sjukdomar i
ryggmärgen
Tilläggskod kan användas för att ange
orsak (kapitel 20)
G93.9
Hjärnsjukdom, ospecificerad
G94*
Andra tillstånd i hjärnan vid
sjukdomar som
klassificeras på annan plats
Myelopati:
• läkemedelsutlöst
• strålningsutlöst
Spinal reflexblåsa UNS
Tilläggskod kan användas för att ange
yttre orsak (kapitel 20)
Utesluter:
Neurogen blåsfunktionsrubbning
orsakad av cauda equina-syndrom
(G83.4)
Neurogen blåsdysfunktion UNS
(N31.9)
Neuromuskulär
blåsfunktionsrubbning utan
omnämnande av ryggmärgsskada
(N31.-)
Aliae conditiones cerebrales
in morbis alibi classificatis
G94.0*
Hydrocefalus vid infektions- och
parasitsjukdomar som
klassificeras på annan plats (A00B99†)
G94.1*
Hydrocefalus vid tumörsjukdom
(C00-D48†)
Akut infarcering av ryggmärgen
Arteriell trombos i ryggmärgen
Hematomyeli
Icke varig intraspinal flebit och
tromboflebit
Subakut nekrotisk myelopati
Ödem i ryggmärgen
G95.9
Sjukdom i ryggmärgen,
ospecificerad
Myelopati UNS
252
G96
Andra sjukdomar i centrala
nervsystemet
G98
Alii morbi systematis nervosi
centralis
G96.0
Alii morbi systematis nervosi
non alibi classificati
Läckage av cerebrospinalvätska
Sjukdom i nervsystemet UNS
Utesluter:
Efter spinalpunktion (G97.0)
G96.1
G99*
Sjukdomar i meningerna som ej
klassificeras på annan plats
Meningeala sammanväxningar
(cerebrala) (spinala)
G96.8
Andra specificerade sjukdomar i
centrala nervsystemet
G96.9
Sjukdom i centrala nervsystemet,
ospecificerad
G97
Sjukdomar i nervsystemet
orsakade av kirurgiska och
medicinska ingrepp som ej
klassificeras på annan plats
G99.0*
Annan reaktion efter spinal- och
lumbalpunktion
G97.2
Intrakraniell hypotension efter
ventrikelshuntning
G97.8
Andra specificerade sjukdomar i
nervsystemet efter kirurgiska och
medicinska ingrepp
G97.9
Sjukdom i nervsystemet efter
kirurgiska och medicinska
ingrepp, ospecificerad
Autonom neuropati vid
endokrina och metaboliska
sjukdomar
Amyloid autonom neuropati
(E85.-†)
Diabetisk autonom neuropati (E10E14† med fjärdeposition .4)
Läckage av cerebrospinalvätska
efter spinalpunktion
G97.1
Andra tillstånd i
nervsystemet vid
sjukdomar som
klassificeras på annan plats
Aliae conditiones systematis
nervosi in morbis alibi
classificatis
Morbi systematis nervosi post
interventiones non alibi
classificati
G97.0
Andra sjukdomar i
nervsystemet som ej
klassificeras på annan plats
G99.1*
Andra tillstånd i autonoma
nervsystemet vid andra
sjukdomar som klassificeras på
annan plats
G99.2*
Myelopati vid sjukdomar som
klassificeras på annan plats
Kompressionssyndrom
motsvarande arteria spinalis
anterior och arteria vertebralis
(M47.0†)
Myelopati vid:
• neoplastisk sjukdom (C00D48†)
• sjukdom i mellankotskivorna
(M50.0†, M51.0†)
• spondylos (M47.-†)
G99.8*
Andra specificerade tillstånd i
nervsystemet vid sjukdomar som
klassificeras på annan plats
Uremisk paralys (N18.5†)
253
Download
Random flashcards
Ölplugg

1 Cards oauth2_google_ed8be09c-94f0-4e6a-8e55-87a3b14a45db

Multiplacation table

156 Cards Антон piter

Fysik

46 Cards oauth2_google_97f6fa87-d6cd-4ae9-bcbf-0f9c2bb34c13

Create flashcards